SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404490958|ref|YP_006715064.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404490958|ref|YP_006715064.1|
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily FlgN-like 7.06e-18
Family FlgN-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404490958|ref|YP_006715064.1|
Sequence length 158
Comment hypothetical protein BLi03786 [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MKRVIEELERLCVLHEHLLSLSEQKTEALKTNEIKALSEIVTKEQKYVQAIEQTEQSRIE
ATKSCIGSSDATISACISKAAGGEKKVLEQLYAKLSQLVTRLKDVNDLNKQLTFQSLQFI
SLTFDMLLPNEGGSNYGKEQQPNQTGGVKRLSLFDSKA
Download sequence
Identical sequences A0A1Y0YKN9 Q65EB2 T5HNQ9
gi|52082077|ref|YP_080868.1| gi|404490958|ref|YP_006715064.1| WP_003185711.1.10695 WP_003185711.1.12567 WP_003185711.1.1290 WP_003185711.1.20727 WP_003185711.1.21456 WP_003185711.1.22930 WP_003185711.1.27377 WP_003185711.1.27603 WP_003185711.1.27836 WP_003185711.1.30581 WP_003185711.1.31090 WP_003185711.1.31877 WP_003185711.1.34504 WP_003185711.1.34863 WP_003185711.1.34956 WP_003185711.1.35726 WP_003185711.1.35764 WP_003185711.1.42641 WP_003185711.1.46361 WP_003185711.1.46635 WP_003185711.1.47006 WP_003185711.1.48016 WP_003185711.1.50447 WP_003185711.1.54544 WP_003185711.1.55910 WP_003185711.1.57471 WP_003185711.1.62441 WP_003185711.1.62618 WP_003185711.1.64701 WP_003185711.1.70162 WP_003185711.1.719 WP_003185711.1.71919 WP_003185711.1.7403 WP_003185711.1.74244 WP_003185711.1.8120 WP_003185711.1.85389 WP_003185711.1.86740 WP_003185711.1.86759 WP_003185711.1.94809 WP_003185711.1.9500 WP_003185711.1.95031 WP_003185711.1.9558 WP_003185711.1.96953 WP_003185711.1.98374 WP_003185711.1.99505 279010.BL03368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]