SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404491157|ref|YP_006715263.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|404491157|ref|YP_006715263.1|
Domain Number - Region: 159-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000889
Family FCH domain 0.084
Further Details:      
 
Domain Number - Region: 5-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00295
Family Myb/SANT domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404491157|ref|YP_006715263.1|
Sequence length 261
Comment transcriptional regulator RsfA [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MKQRQDAWSEENDLLLAETVLRHVREGSTQLNAFEEVGDRLNRTSAACGFRWNAVVRHQY
EKALQLAKKQRKQRMRALGNGQPAKKRLLYKPPVETNAEPPAESVVEQKKATADSSEQQP
IASEHLPYVDESFKEELASLSHLLSPNQPQAGHTADTSKDMTIDDVIRFLQNYTGNEEQT
AALKMENERLKQENEELTKKVEKLEAEVKKLEKDQTTIQEDYETLVKIMNRARKLVLFEE
DEHAAPAFKMDRNGNLEKMAE
Download sequence
Identical sequences A0A1Y0YWI3 Q65DR5 T5HKV6
gi|404491157|ref|YP_006715263.1| 279010.BL03960 gi|52082271|ref|YP_081062.1| WP_003186098.1.10695 WP_003186098.1.12567 WP_003186098.1.20727 WP_003186098.1.21456 WP_003186098.1.22930 WP_003186098.1.27377 WP_003186098.1.27603 WP_003186098.1.27836 WP_003186098.1.30581 WP_003186098.1.31090 WP_003186098.1.31877 WP_003186098.1.34504 WP_003186098.1.34863 WP_003186098.1.34956 WP_003186098.1.35726 WP_003186098.1.35764 WP_003186098.1.42641 WP_003186098.1.46361 WP_003186098.1.46635 WP_003186098.1.47006 WP_003186098.1.48016 WP_003186098.1.50447 WP_003186098.1.54544 WP_003186098.1.57471 WP_003186098.1.62441 WP_003186098.1.70162 WP_003186098.1.719 WP_003186098.1.71919 WP_003186098.1.7403 WP_003186098.1.8120 WP_003186098.1.82128 WP_003186098.1.85389 WP_003186098.1.86740 WP_003186098.1.95031 WP_003186098.1.9558 WP_003186098.1.98374 WP_003186098.1.99505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]