SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404487413|ref|YP_006711519.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404487413|ref|YP_006711519.1|
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily YjgF-like 5.5e-49
Family YjgF/L-PSP 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404487413|ref|YP_006711519.1|
Sequence length 125
Comment purine operon regulator YabJ [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MTKVVQTKEAPAAIGPYSQGIVVNNMFYSSGQIPLTPSGEMVTGDITEQTHQVFRNLKAV
LKEAGASLETVVKATVFLADMNQFTEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEV
IALVK
Download sequence
Identical sequences A0A1R1RQ41 A0A1Y0YCS4 Q65PH3 T5HUY3
WP_003178196.1.10695 WP_003178196.1.12567 WP_003178196.1.1290 WP_003178196.1.20727 WP_003178196.1.21456 WP_003178196.1.22930 WP_003178196.1.27377 WP_003178196.1.27836 WP_003178196.1.30581 WP_003178196.1.31090 WP_003178196.1.31877 WP_003178196.1.34504 WP_003178196.1.34863 WP_003178196.1.34956 WP_003178196.1.35726 WP_003178196.1.35764 WP_003178196.1.42641 WP_003178196.1.46361 WP_003178196.1.46635 WP_003178196.1.47006 WP_003178196.1.48016 WP_003178196.1.50447 WP_003178196.1.54544 WP_003178196.1.55910 WP_003178196.1.57471 WP_003178196.1.62231 WP_003178196.1.62441 WP_003178196.1.62618 WP_003178196.1.64701 WP_003178196.1.70162 WP_003178196.1.719 WP_003178196.1.71919 WP_003178196.1.7403 WP_003178196.1.74244 WP_003178196.1.8120 WP_003178196.1.85389 WP_003178196.1.8660 WP_003178196.1.86740 WP_003178196.1.86759 WP_003178196.1.94809 WP_003178196.1.9500 WP_003178196.1.95031 WP_003178196.1.9558 WP_003178196.1.96953 WP_003178196.1.98374 WP_003178196.1.99505 gi|52078543|ref|YP_077334.1| 279010.BL00522 gi|404487413|ref|YP_006711519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]