SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|408502211|ref|YP_006869655.1| from Treponema pallidum subsp. pallidum str. Mexico A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408502211|ref|YP_006869655.1|
Domain Number 1 Region: 19-136,168-490
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-146
Family GABA-aminotransferase-like 0.0000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408502211|ref|YP_006869655.1|
Sequence length 513
Comment glycine hydroxymethyltransferase [Treponema pallidum subsp. pallidum str. Mexico A]
Sequence
MNNSALRAYLSTRAPDQIHSAFVAYLANLDLVAHQFPQIASDIVQELIDQRSYVKLIASE
NYSSLAVQAAMANLLTDKYAEGFPHHRYYGGCQNVDSIESAAAAEACALFGAEHAYVQPH
SGADANLVAFWAILSRQIEMPTLSSLGVTAATHLSEEQWEVLRQKMGNQKLMGLDYFSGG
HLTHGYRQNVSGRMFRVVSYAVDRDTGLLDYAAIEAQAKRERPLILLAGYSAYPRSINFR
IFREIADKVGAVLMADMAHFAGLVAGGVFTGDEDPVRWSHIVTSTTHKTLRGPRGAFILC
KKEFAEAVDKGCPLVLGGPLPHVMAAKAVAFREARNAAFKTYAHAVRDNARALADACIQQ
GMQLQTGGTDNHLLLLDVRPFGLTGRQAERALIDCGVTLNRNSLPFDPNGAWLTSGLRIG
TPAVTSLGMGPEEMKRIARLIARVLGAATPVRTKTGALSKSAAEVPGEVRSSVCSEVREL
LARFTLYPELDEPFLRAHFTRRPADKTPADEGT
Download sequence
Identical sequences A0A0A7X2S5 H6KUN0 R9UWC5
gi|488657743|ref|YP_007936125.1| gi|512443802|ref|YP_008119081.1| gi|378973896|ref|YP_005222502.1| gi|378972829|ref|YP_005221433.1| gi|378981805|ref|YP_005230110.1| WP_014342373.1.101681 WP_014342373.1.10609 WP_014342373.1.11013 WP_014342373.1.177 WP_014342373.1.22706 WP_014342373.1.24110 WP_014342373.1.24144 WP_014342373.1.26337 WP_014342373.1.26670 WP_014342373.1.28216 WP_014342373.1.31174 WP_014342373.1.34567 WP_014342373.1.35526 WP_014342373.1.35589 WP_014342373.1.37724 WP_014342373.1.38137 WP_014342373.1.38252 WP_014342373.1.38852 WP_014342373.1.39803 WP_014342373.1.41302 WP_014342373.1.42739 WP_014342373.1.42752 WP_014342373.1.43796 WP_014342373.1.44774 WP_014342373.1.45335 WP_014342373.1.49513 WP_014342373.1.50901 WP_014342373.1.51333 WP_014342373.1.6132 WP_014342373.1.61389 WP_014342373.1.63356 WP_014342373.1.72815 WP_014342373.1.73546 WP_014342373.1.74079 WP_014342373.1.78381 WP_014342373.1.79283 WP_014342373.1.82112 WP_014342373.1.89996 WP_014342373.1.90600 WP_014342373.1.90779 WP_014342373.1.92130 WP_014342373.1.96085 WP_014342373.1.98226 WP_014342373.1.98956 WP_014342373.1.99137 WP_014342373.1.99367 gi|408502211|ref|YP_006869655.1| gi|378974958|ref|YP_005223566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]