SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54293310|ref|YP_125725.1| from Legionella pneumophila str. Lens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54293310|ref|YP_125725.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.49e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.81e-27
Family Ribosomal protein L11, C-terminal domain 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54293310|ref|YP_125725.1|
Sequence length 144
Comment 50S ribosomal protein L11 [Legionella pneumophila str. Lens]
Sequence
MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQMEQGLPIPVVIT
VYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVSQLEEIAKVKKPDLTAA
DLAAAVRSIAGTARSMGIEVEGLE
Download sequence
Identical sequences A0A129GAH4 A0A1S8GF52 A0A2J9NMH9 A5IHS5 G8USF5 Q5WZM3 Q5X870 Q5ZYQ4
272624.lpg0318 297245.lpl0358 297246.lpp0383 400673.LPC_3025 gi|509149659|ref|YP_008062033.1| gi|54293310|ref|YP_125725.1| gi|54296354|ref|YP_122723.1| gi|397662886|ref|YP_006504424.1| gi|52840563|ref|YP_094362.1| gi|470183582|ref|YP_007569457.1| WP_010946069.1.100609 WP_010946069.1.100881 WP_010946069.1.101188 WP_010946069.1.101326 WP_010946069.1.101385 WP_010946069.1.101551 WP_010946069.1.10160 WP_010946069.1.101751 WP_010946069.1.101869 WP_010946069.1.10234 WP_010946069.1.10632 WP_010946069.1.10829 WP_010946069.1.11317 WP_010946069.1.11666 WP_010946069.1.1173 WP_010946069.1.11786 WP_010946069.1.1188 WP_010946069.1.12035 WP_010946069.1.12039 WP_010946069.1.1206 WP_010946069.1.12661 WP_010946069.1.12916 WP_010946069.1.13050 WP_010946069.1.13961 WP_010946069.1.14235 WP_010946069.1.14270 WP_010946069.1.14396 WP_010946069.1.15016 WP_010946069.1.15769 WP_010946069.1.16040 WP_010946069.1.16078 WP_010946069.1.16593 WP_010946069.1.16601 WP_010946069.1.16626 WP_010946069.1.16748 WP_010946069.1.17092 WP_010946069.1.17351 WP_010946069.1.17430 WP_010946069.1.17548 WP_010946069.1.17681 WP_010946069.1.17809 WP_010946069.1.17841 WP_010946069.1.17857 WP_010946069.1.17948 WP_010946069.1.18568 WP_010946069.1.19186 WP_010946069.1.19321 WP_010946069.1.19554 WP_010946069.1.19781 WP_010946069.1.20369 WP_010946069.1.2062 WP_010946069.1.2085 WP_010946069.1.20993 WP_010946069.1.21168 WP_010946069.1.21466 WP_010946069.1.21493 WP_010946069.1.21504 WP_010946069.1.21543 WP_010946069.1.21849 WP_010946069.1.21924 WP_010946069.1.22039 WP_010946069.1.2239 WP_010946069.1.22734 WP_010946069.1.22766 WP_010946069.1.23 WP_010946069.1.2333 WP_010946069.1.23459 WP_010946069.1.23866 WP_010946069.1.2394 WP_010946069.1.24053 WP_010946069.1.24295 WP_010946069.1.24333 WP_010946069.1.2441 WP_010946069.1.24636 WP_010946069.1.24659 WP_010946069.1.24790 WP_010946069.1.24881 WP_010946069.1.2526 WP_010946069.1.25399 WP_010946069.1.25422 WP_010946069.1.25566 WP_010946069.1.25619 WP_010946069.1.25858 WP_010946069.1.26718 WP_010946069.1.27038 WP_010946069.1.27113 WP_010946069.1.27354 WP_010946069.1.27501 WP_010946069.1.27538 WP_010946069.1.27674 WP_010946069.1.27676 WP_010946069.1.28020 WP_010946069.1.28040 WP_010946069.1.28346 WP_010946069.1.28686 WP_010946069.1.2872 WP_010946069.1.28721 WP_010946069.1.28782 WP_010946069.1.28814 WP_010946069.1.2919 WP_010946069.1.29318 WP_010946069.1.29425 WP_010946069.1.29598 WP_010946069.1.29717 WP_010946069.1.29802 WP_010946069.1.29930 WP_010946069.1.30122 WP_010946069.1.30240 WP_010946069.1.30351 WP_010946069.1.30513 WP_010946069.1.30578 WP_010946069.1.30583 WP_010946069.1.30653 WP_010946069.1.30717 WP_010946069.1.30822 WP_010946069.1.3115 WP_010946069.1.3122 WP_010946069.1.31291 WP_010946069.1.31301 WP_010946069.1.31862 WP_010946069.1.32367 WP_010946069.1.3258 WP_010946069.1.32608 WP_010946069.1.32615 WP_010946069.1.32659 WP_010946069.1.32970 WP_010946069.1.33232 WP_010946069.1.33479 WP_010946069.1.3365 WP_010946069.1.33708 WP_010946069.1.34167 WP_010946069.1.34228 WP_010946069.1.34246 WP_010946069.1.34463 WP_010946069.1.34671 WP_010946069.1.35082 WP_010946069.1.35118 WP_010946069.1.35787 WP_010946069.1.35792 WP_010946069.1.35807 WP_010946069.1.36016 WP_010946069.1.36350 WP_010946069.1.36420 WP_010946069.1.36520 WP_010946069.1.36556 WP_010946069.1.36852 WP_010946069.1.37078 WP_010946069.1.37108 WP_010946069.1.37161 WP_010946069.1.37274 WP_010946069.1.37322 WP_010946069.1.37616 WP_010946069.1.37678 WP_010946069.1.37757 WP_010946069.1.37792 WP_010946069.1.37932 WP_010946069.1.38133 WP_010946069.1.38174 WP_010946069.1.3819 WP_010946069.1.38414 WP_010946069.1.38444 WP_010946069.1.38634 WP_010946069.1.38679 WP_010946069.1.38809 WP_010946069.1.38919 WP_010946069.1.3933 WP_010946069.1.39491 WP_010946069.1.39582 WP_010946069.1.40024 WP_010946069.1.40151 WP_010946069.1.40375 WP_010946069.1.40835 WP_010946069.1.40870 WP_010946069.1.41061 WP_010946069.1.41185 WP_010946069.1.41194 WP_010946069.1.41378 WP_010946069.1.41396 WP_010946069.1.41414 WP_010946069.1.41486 WP_010946069.1.41585 WP_010946069.1.41639 WP_010946069.1.42405 WP_010946069.1.42431 WP_010946069.1.43145 WP_010946069.1.43838 WP_010946069.1.44619 WP_010946069.1.44696 WP_010946069.1.44866 WP_010946069.1.44947 WP_010946069.1.45024 WP_010946069.1.45039 WP_010946069.1.45368 WP_010946069.1.46042 WP_010946069.1.46096 WP_010946069.1.46375 WP_010946069.1.46948 WP_010946069.1.47329 WP_010946069.1.47341 WP_010946069.1.47557 WP_010946069.1.47638 WP_010946069.1.47725 WP_010946069.1.47823 WP_010946069.1.47956 WP_010946069.1.48346 WP_010946069.1.4842 WP_010946069.1.48466 WP_010946069.1.48523 WP_010946069.1.48881 WP_010946069.1.48987 WP_010946069.1.49404 WP_010946069.1.4947 WP_010946069.1.49562 WP_010946069.1.50306 WP_010946069.1.50379 WP_010946069.1.50772 WP_010946069.1.50792 WP_010946069.1.50842 WP_010946069.1.51024 WP_010946069.1.51153 WP_010946069.1.51257 WP_010946069.1.51428 WP_010946069.1.51685 WP_010946069.1.51956 WP_010946069.1.51958 WP_010946069.1.51991 WP_010946069.1.52283 WP_010946069.1.52439 WP_010946069.1.5252 WP_010946069.1.5268 WP_010946069.1.52706 WP_010946069.1.52723 WP_010946069.1.52787 WP_010946069.1.52905 WP_010946069.1.52911 WP_010946069.1.53134 WP_010946069.1.53250 WP_010946069.1.53261 WP_010946069.1.53443 WP_010946069.1.53474 WP_010946069.1.53602 WP_010946069.1.5363 WP_010946069.1.53669 WP_010946069.1.53795 WP_010946069.1.53844 WP_010946069.1.54355 WP_010946069.1.54450 WP_010946069.1.54472 WP_010946069.1.547 WP_010946069.1.54704 WP_010946069.1.54747 WP_010946069.1.54834 WP_010946069.1.55083 WP_010946069.1.55380 WP_010946069.1.5553 WP_010946069.1.56486 WP_010946069.1.5660 WP_010946069.1.56801 WP_010946069.1.56857 WP_010946069.1.57055 WP_010946069.1.57468 WP_010946069.1.57482 WP_010946069.1.57907 WP_010946069.1.58065 WP_010946069.1.58425 WP_010946069.1.58541 WP_010946069.1.58590 WP_010946069.1.58606 WP_010946069.1.5861 WP_010946069.1.58655 WP_010946069.1.58658 WP_010946069.1.58764 WP_010946069.1.58931 WP_010946069.1.59183 WP_010946069.1.59227 WP_010946069.1.59576 WP_010946069.1.59692 WP_010946069.1.59940 WP_010946069.1.60120 WP_010946069.1.60239 WP_010946069.1.6043 WP_010946069.1.60442 WP_010946069.1.60770 WP_010946069.1.61227 WP_010946069.1.61482 WP_010946069.1.61570 WP_010946069.1.61895 WP_010946069.1.62077 WP_010946069.1.62255 WP_010946069.1.62386 WP_010946069.1.6243 WP_010946069.1.62610 WP_010946069.1.62652 WP_010946069.1.62869 WP_010946069.1.63249 WP_010946069.1.63282 WP_010946069.1.63357 WP_010946069.1.636 WP_010946069.1.63686 WP_010946069.1.64049 WP_010946069.1.64298 WP_010946069.1.64335 WP_010946069.1.64388 WP_010946069.1.64512 WP_010946069.1.64714 WP_010946069.1.64856 WP_010946069.1.64936 WP_010946069.1.65356 WP_010946069.1.65444 WP_010946069.1.65604 WP_010946069.1.6601 WP_010946069.1.66058 WP_010946069.1.66209 WP_010946069.1.66299 WP_010946069.1.6641 WP_010946069.1.6663 WP_010946069.1.66827 WP_010946069.1.66942 WP_010946069.1.66949 WP_010946069.1.67291 WP_010946069.1.67348 WP_010946069.1.67448 WP_010946069.1.67497 WP_010946069.1.67503 WP_010946069.1.67763 WP_010946069.1.68151 WP_010946069.1.68412 WP_010946069.1.68702 WP_010946069.1.68780 WP_010946069.1.68977 WP_010946069.1.69197 WP_010946069.1.69332 WP_010946069.1.696 WP_010946069.1.69880 WP_010946069.1.70346 WP_010946069.1.70654 WP_010946069.1.7066 WP_010946069.1.70691 WP_010946069.1.70860 WP_010946069.1.7124 WP_010946069.1.71556 WP_010946069.1.71674 WP_010946069.1.7196 WP_010946069.1.72375 WP_010946069.1.72557 WP_010946069.1.72722 WP_010946069.1.728 WP_010946069.1.73029 WP_010946069.1.7313 WP_010946069.1.73276 WP_010946069.1.73409 WP_010946069.1.73575 WP_010946069.1.73915 WP_010946069.1.74003 WP_010946069.1.74052 WP_010946069.1.74197 WP_010946069.1.74371 WP_010946069.1.74412 WP_010946069.1.74438 WP_010946069.1.7452 WP_010946069.1.75016 WP_010946069.1.75242 WP_010946069.1.75285 WP_010946069.1.75353 WP_010946069.1.75911 WP_010946069.1.75926 WP_010946069.1.7619 WP_010946069.1.76246 WP_010946069.1.76298 WP_010946069.1.76893 WP_010946069.1.7695 WP_010946069.1.77106 WP_010946069.1.77227 WP_010946069.1.77360 WP_010946069.1.77472 WP_010946069.1.77695 WP_010946069.1.77829 WP_010946069.1.77852 WP_010946069.1.77866 WP_010946069.1.78342 WP_010946069.1.78899 WP_010946069.1.79027 WP_010946069.1.79030 WP_010946069.1.79209 WP_010946069.1.79331 WP_010946069.1.79384 WP_010946069.1.79423 WP_010946069.1.79768 WP_010946069.1.79852 WP_010946069.1.79957 WP_010946069.1.79998 WP_010946069.1.80041 WP_010946069.1.80208 WP_010946069.1.80246 WP_010946069.1.80284 WP_010946069.1.80459 WP_010946069.1.80464 WP_010946069.1.80678 WP_010946069.1.80679 WP_010946069.1.80733 WP_010946069.1.80817 WP_010946069.1.80844 WP_010946069.1.80921 WP_010946069.1.81040 WP_010946069.1.81762 WP_010946069.1.81849 WP_010946069.1.81970 WP_010946069.1.82004 WP_010946069.1.82012 WP_010946069.1.82765 WP_010946069.1.82883 WP_010946069.1.83017 WP_010946069.1.83062 WP_010946069.1.83114 WP_010946069.1.83499 WP_010946069.1.8363 WP_010946069.1.83658 WP_010946069.1.83690 WP_010946069.1.84032 WP_010946069.1.8407 WP_010946069.1.84081 WP_010946069.1.84310 WP_010946069.1.84341 WP_010946069.1.84474 WP_010946069.1.84649 WP_010946069.1.85643 WP_010946069.1.85655 WP_010946069.1.85699 WP_010946069.1.85818 WP_010946069.1.85821 WP_010946069.1.86050 WP_010946069.1.86349 WP_010946069.1.86462 WP_010946069.1.86607 WP_010946069.1.87014 WP_010946069.1.87029 WP_010946069.1.87225 WP_010946069.1.87431 WP_010946069.1.87629 WP_010946069.1.87656 WP_010946069.1.87917 WP_010946069.1.88023 WP_010946069.1.88081 WP_010946069.1.88271 WP_010946069.1.88601 WP_010946069.1.88749 WP_010946069.1.89129 WP_010946069.1.89135 WP_010946069.1.89155 WP_010946069.1.89171 WP_010946069.1.90392 WP_010946069.1.90650 WP_010946069.1.90718 WP_010946069.1.90773 WP_010946069.1.90915 WP_010946069.1.91040 WP_010946069.1.91183 WP_010946069.1.91256 WP_010946069.1.91480 WP_010946069.1.9248 WP_010946069.1.92599 WP_010946069.1.92683 WP_010946069.1.9284 WP_010946069.1.93162 WP_010946069.1.93200 WP_010946069.1.93993 WP_010946069.1.93995 WP_010946069.1.94044 WP_010946069.1.94262 WP_010946069.1.94483 WP_010946069.1.9449 WP_010946069.1.94508 WP_010946069.1.94611 WP_010946069.1.95613 WP_010946069.1.9567 WP_010946069.1.9568 WP_010946069.1.95686 WP_010946069.1.95895 WP_010946069.1.96018 WP_010946069.1.96198 WP_010946069.1.96370 WP_010946069.1.96522 WP_010946069.1.97528 WP_010946069.1.97598 WP_010946069.1.97635 WP_010946069.1.97638 WP_010946069.1.97848 WP_010946069.1.97870 WP_010946069.1.97946 WP_010946069.1.97957 WP_010946069.1.9807 WP_010946069.1.98134 WP_010946069.1.98163 WP_010946069.1.98470 WP_010946069.1.98579 WP_010946069.1.98839 WP_010946069.1.98841 WP_010946069.1.98916 WP_010946069.1.98928 WP_010946069.1.99113 WP_010946069.1.99481 WP_010946069.1.99514 WP_010946069.1.9953 WP_010946069.1.9955 WP_010946069.1.9970 WP_010946069.1.99767 WP_010946069.1.9980 WP_010946069.1.99870 WP_010946069.1.99939 YP_094362.1.86292 gi|148361064|ref|YP_001252271.1| gi|378776264|ref|YP_005184696.1| gi|296105867|ref|YP_003617567.1| gi|397665998|ref|YP_006507535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]