SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ11_V3.0270 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ11_V3.0270
Domain Number 1 Region: 51-157
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.19e-16
Family Ferredoxin reductase FAD-binding domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 141-332
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000691
Family Reductases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ11_V3.0270
Sequence length 345
Comment | organism=Leishmania_infantum | product=NADH-cytochrome b5 reductase-like protein | location=Lin.chr11:78276-79313(+) | length=345
Sequence
MFNDVNKGYVTRVTAAVATAFGMSYAVYTLVLQPTQQRRPLAKRWSWCAPPVPITLVEKN
GEKGSSMFVYRFALPNSYDYAGYEPVSSVRMMSGNVRELSSLSRWYTPISHPDERGFIEF
AIKDCDPGRMSARLRYLEPGDIVYLGRWMREFPYQPNTFKELGVVCTTSGASVALQLMNI
MDKNKADDTKLSLLYCHHTATDIPFKDTFFKAYAERNKNRIQVSYNVLAGGRRRGSAAPI
EPNMYVGNIDPETIAAALPPPVRIVEAGAGVGSGTASQLATYRPQLLICGPQSMLAFLCG
RVSSFGNYGYWQGPFYRYSGFLKDMGYTRSQVYKFGVSTHFLADH
Download sequence
Identical sequences A4HUT9
psu|LinJ11_V3.0270 XP_001463830.1.40037 5671.LinJ11.0270 gi|146079684|ref|XP_001463830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]