SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LinJ16_V31550 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ16_V31550
Domain Number 1 Region: 117-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-91
Family Motor proteins 0.00000393
Further Details:      
 
Domain Number 2 Region: 2308-2523
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000213
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number 3 Region: 2454-2653
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000497
Family Tropomyosin 0.00092
Further Details:      
 
Domain Number 4 Region: 828-1016
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000915
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 5 Region: 1792-1972
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000015
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 6 Region: 667-853
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000137
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 7 Region: 1024-1246
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000981
Family Tropomyosin 0.0017
Further Details:      
 
Weak hits

Sequence:  psu|LinJ16_V31550
Domain Number - Region: 1652-1768
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0105
Family Myosin rod fragments 0.0026
Further Details:      
 
Domain Number - Region: 1371-1490
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0214
Family Myosin rod fragments 0.002
Further Details:      
 
Domain Number - Region: 1457-1563
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.0033
Further Details:      
 
Domain Number - Region: 2108-2214
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ16_V31550
Sequence length 2811
Comment | organism=Leishmania_infantum | product=kinesin, putative | location=Lin.chr16:598485-606920(-) | length=2811
Sequence
MEFKRSNSSRGPLRSGRRGHPVGVATPKRSTTPLKKNSERGAPTPPAAAGPAASPAPPLP
PRTPEPQSARYSAKESPRPPSTTTFERSVSGTGSKGTFKRSATAVGMRRAEAIKHNNRVN
VYVRVRAFREDETSGDMGQLAVNMDDSAVEVTVPKKGRFTFGFDGCFWSNDRACPSGKAS
ASQEDVFDEVGRPLVENALAGYNAAVMAYGQTGSGKTYTSFGPPGSIGTSQEGLIPRVCN
MIFSRAANSAQKGVTYTVSASMLEVYLEDVFDLLNHRKQLSVRNDFTSNTFSVVGQKTVP
VNSYMDVLAVLNKAEPLRTFAATNIHDHSSRAHTLFMLEVQTHFDAPDLAPRCAKILLAD
LAGCERIRLAGTEEGLAFEQARNINLSLLALGSCIEAVATRGRGSSRPIPEFRNSTLTKL
LKDYIGGNSISTMMVTISPSERDANLSVQTLRFADRAKQITTHAHVNTVDPQQAKQDGSE
LGDRWRDEYLRKKEALYAEYQLKGTIEKLLARIAELEARLRECADDEFALHLTTEIEELQ
KALTEADYQMGLQRQILYGEFLLLEDELRELNTKMQEMKEEHEEAMEGILGEEAGRFEEM
KRGYETRLRALQSESDAALAASTDEIAALRRLVAELQERLAAKEAECADLAGRLSALQVK
YDADTCAAERARSELEAQLAESEKQVGELAERQTQIMLEEETLKATVERLNADMESTEET
LQETSAKLADTEETLQETSAKLANTEEALQETSAKLADTEETLQETSAKLADTEETLQET
SAKLADTEEALQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKL
ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSA
KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLAD
TEETLQETSAKLAGTEEALQETFAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
SAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKL
ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
EALQETSAKLADTEEALQETSAKLADTEETLQETSAKLAGTEEALQETSAKLADTEEALQ
ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLADTEETLQETSA
KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLAD
TEETLQETSAKLAGTEEALQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
LQETSAKLAGTEEALQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
SAKLADTEETLQETSAKLADTEEALQETSAKLADTEETLQETSAKLAGTEEALQETSAKL
ADTEETLQETSAKLAGTEEALQETFAKLADTEETLQETSAKLADTEETLQETSAKLADTE
ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSA
KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLAD
TEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
SAKLAGTEEALQETSAKLADTEEALQETSAKLADTEEALQETSAKLADTEETLQETSAKL
ADTEETLQETSAKLAGTEEALQETSAKLADTEETLQETSAKLADTEETLQETSSKLADTE
EALQETSAKLADTEETLQETSAKLADTEETLQETSSKLADTEEALQETSAKLADTEEALQ
ETSAKLADTEEALQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSA
KLADTEEALQETSAKLADTEEALQETSAKLADTEEALQETSAKLADTEETLQETSAKLAD
TEETLQETSAKLAGTEEALQETSAKLADTEETLQETSAKLADTEETLQETSSKLADTEEA
LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQET
SAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLADTEETLQETSAKL
ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEEALQETSAKLADTE
ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
ETSAKLADTEEMRAAEIASLTEQLGVAHSLAEQHCAYMNQLMAYVNAAYNVTLDGMTELQ
ATALADMLRQCDYVLRSVAQAATDEVEHVKEMYHMVAGNYKETAARFDILRRILGKIDQD
VKEASVEIDAPERRQTGSLNPTPRRLGDVSNRENSMESKTRSSSRLSARPL
Download sequence
Identical sequences A4HX43
XP_001464634.2.40037 psu|LinJ16_V31550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]