SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LinJ32_V3.1040 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ32_V3.1040
Domain Number 1 Region: 274-335
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000000000000785
Family VPS23 C-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  psu|LinJ32_V3.1040
Domain Number - Region: 77-152
Classification Level Classification E-value
Superfamily UBC-like 0.00227
Family UBC-related 0.021
Further Details:      
 
Domain Number - Region: 364-407
Classification Level Classification E-value
Superfamily UBA-like 0.0034
Family CUE domain 0.028
Further Details:      
 
Domain Number - Region: 199-288
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ32_V3.1040
Sequence length 409
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=Lin.chr32_V3:396505-397734(+) | length=409
Sequence
MELTLHQAADISIVSQYYSPVAASAITYAISNFLPYANNFPNAKVRLTPGKDIAEPLHFE
CFLTIRKSPQDTQGTPLLVVISFADHYPQQMPSAVLVPPPGGEKIKHPYSVMSIDGRIQV
ECLSFLRGVVRPYSLLDMLLAISEQFELEYPLVGANYVPPTAAASDLLSAQSAELSDMDP
ARQSLVQEAAERVVIDVNQKASKYLDMREQALLYLQKLNESNRELQRAKEILTEHQDELQ
EYLPSVGSVSSLVRQLDGHEDTVEEHANCLVPADPLQARALELLAEIHAADDTLALLEEG
LKRELMTCDDYVKNVSDVGREQFVSRHLYLKVSDKLGKTSSGAAATTPVSTPPPGQSPRS
PPEVPQRLAPTEALRMEFPSADVDVIRDVLASVEGDLTIARQQLKMMFP
Download sequence
Identical sequences A4I7R5
psu|LinJ32_V3.1040 XP_001467784.1.40037 gi|146096370|ref|XP_001467784.1| 5671.LinJ32.1390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]