SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16799328|ref|NP_469596.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16799328|ref|NP_469596.1|
Domain Number 1 Region: 455-646
Classification Level Classification E-value
Superfamily PRTase-like 6.03e-61
Family Phosphoribosyltransferases (PRTases) 0.00000349
Further Details:      
 
Domain Number 2 Region: 9-240
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.5e-58
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 3 Region: 344-444
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.14e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 4 Region: 217-325
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000523
Family MesJ substrate recognition domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16799328|ref|NP_469596.1|
Sequence length 648
Comment hypothetical protein lin0251 [Listeria innocua Clip11262]
Sequence
MDDTKKRIHKYIEKHDLIRSDDKLLVAVSGGPDSFALLHFLWSANLVPKEAIAVAHLNHH
LRENAEKEQLAVQTFCEERDIPFFIEEVDVKKRAEKLQKGIEETARIVRYDFFEKVMAEN
NINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKREVRGGYAIRPFLPITKAEIIEY
ATKHALPYEIDESNTSQEYTRNRYRTQLLPFLSKENPAVYEHFKRFSEETSEDFQFLEEL
ASNLLKKNLIQNGKQSTLLLSDFKNEANPLQRRAIHLLLMYLYNDDGRVITVNHIYQIIQ
MIQSENPSSSIDLPKKLTVIRSYNELHFQFGERHAPPEFYHQLELNDRIELDNKASIRLK
LKSSVVQTNGLNGMLLDAEDITLPLIVRNRVNGDRMTMKGQAGSKKLKDIFIDAKIPRQE
RDNLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYIIRYTRNIGGNESMHNDIQKVLIS
EDELQEKIRELGRELTAEYEGRNPLVVGVLKGATPFMTDLLKRIDTYLEMDFMDVSSYGN
GTVSSGEVKIIKDLNASVEGRDVLIIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTLLDKP
AGRNVAIEADYVGFVVPNEFVVGYGLDYAERYRNLPYIGILKPEIYSE
Download sequence
Identical sequences Q92F56
gi|16799328|ref|NP_469596.1| WP_010990297.1.46653 272626.lin0251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]