SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16800254|ref|NP_470522.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16800254|ref|NP_470522.1|
Domain Number 1 Region: 209-406
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-60
Family B3/B4 domain of PheRS, PheT 0.0000169
Further Details:      
 
Domain Number 2 Region: 475-696
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-52
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000739
Further Details:      
 
Domain Number 3 Region: 36-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-44
Family Myf domain 0.0074
Further Details:      
 
Domain Number 4 Region: 704-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.11e-30
Family Anticodon-binding domain of PheRS 0.00043
Further Details:      
 
Domain Number 5 Region: 412-483
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.84e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16800254|ref|NP_470522.1|
Sequence length 802
Comment phenylalanyl-tRNA synthetase subunit beta [Listeria innocua Clip11262]
Sequence
MLVSYNWVKEFFQDFPLTAEELGEAITRTGIEIEGVEELSASLKNVVVGEVLSCERHPDA
EKLNKCLVQTDEEEPVQIICGAPNVAAGQKVIVAKVGARLPGGLKIKRAKLRGEVSEGMI
CSLAELGFESKVVPKAYADGIYVLPEHVETGVSAITLLGLDDAILDMAITPNRADALSMN
GVAHEVGAIIHQKPAQPTEPDVSEKGKADDFISVEVENPTETPYYAIKMVENIEIKESPL
WLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIGSKKIVVRSAKDQEEITTLD
GEKRILQTGHTVITNGTEPIAIAGVMGGEFSEVTETTTTVALEGAIFSSSSVGKASRELY
LRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVGGVVEVDNREKAVNKIETSLTR
INRILGTEISLSEIETIFDRLGFVLEVKEDTLIIEVPTRRWDITIEADILEEVARIYGYD
EIPVTLPATSTTGGLSDSQKARRVMRAYLEGAGLNQALTYSLTSKKDATRLALSDEKTVA
LSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVALYEMGTVFYATEGDNLPIEQEHLA
GLITGNWHTADWQKTPKPVDFFVLKGIVEGLVNKLGIEAELHWKQIEKEELHPGRTASIQ
LEGKEIGYLGALHPAVEASYDLKETYVFEINVKALLDATKEKVVYHPIPRYPEMTRDLAL
LVDKDTDHATISQVIKEHGGNLLVDIELFDIFEGESLGENKKSLAYTLTFLDSERTLVEE
DVQKATNKVVEALQAKLHAIIR
Download sequence
Identical sequences Q92CI6
WP_010990817.1.46653 gi|16800254|ref|NP_470522.1| 272626.lin1185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]