SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16801000|ref|NP_471268.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16801000|ref|NP_471268.1|
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-83
Family Protein kinases, catalytic subunit 0.00000116
Further Details:      
 
Domain Number 2 Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000497
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|16801000|ref|NP_471268.1|
Domain Number - Region: 369-430
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 435-491
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0497
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16801000|ref|NP_471268.1|
Sequence length 657
Comment hypothetical protein lin1934 [Listeria innocua Clip11262]
Sequence
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIQENHPISYDKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQAEIPSARAQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFPTNDDDGDTKTIPIIAT
KEAMQNLDKTIVPEGKVAAEEVAVDDKKGKKKKKMSKKKKIILIVSSVIVLFIIGILLLW
LLGKSPDEVAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDDVEEGKVINTDPSAGEMK
EKGTKINLFVSIGSKKITMEDYTGRSYSETKTLLEQQGFNNISAEEAYSSEVGKGMIISQ
TPTQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSKEENSNSV
EKGQVISQSPSAGTAINAGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKVQ
IYIQDKDHSMTSAYREMNITQNTSVEVTFQIEEGSSAGYKIISDDKVIDEGTVPYPN
Download sequence
Identical sequences H1G8G8 Q92AI8
gi|16801000|ref|NP_471268.1| WP_003769293.1.46653 WP_003769293.1.99521 WP_003769293.1.99921 272626.lin1934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]