SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16801211|ref|NP_471479.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16801211|ref|NP_471479.1|
Domain Number 1 Region: 194-614
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.63e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.000000887
Further Details:      
 
Domain Number 2 Region: 56-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.96e-46
Family Penicillin binding protein dimerisation domain 0.0000248
Further Details:      
 
Domain Number 3 Region: 603-657
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0045
Further Details:      
 
Domain Number 4 Region: 659-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16801211|ref|NP_471479.1|
Sequence length 752
Comment hypothetical protein lin2145 [Listeria innocua Clip11262]
Sequence
MKRRIGNMRRGALVLFIFFTILFLLVSGRFLYLQITGEANGVPLAAKASKQHLKSSVLEA
KRGSILDRKGEVLAEDTASYTIAAVVSDKLSKTTKNPMRVVDEEKTARILAKYIPMDESD
ILDKLNEKGKYQVEFGSAGKNISTETKAKIDKENLPGIEFTRQSERFYPNGTFATQLIGF
AQQEEEKNTTKLEGKMGIESSYNDILTGKNGKIDYSTDRMGYILPDSKNKVTEAKDGKDI
TLTLDKKIQTFLEDTMTTVDAKYKPKNMMAVVADPKTGEILAISQRPSFNPADRSTITGN
SSSIWQDLPVEYAYEPGSVMKIISLASAIDKNVYNPNEYYQSGSYKVGDIAIHDHNNGNG
WGLIPYREGVERSSNVAFAKLLNKMGTDTFKTYLDKFGFGKKTGIALPNETKGKILYNYP
IEKVTTVFGQGTTVSMMQMIQAASAIASDGTMKEPYVVSSVKDTNTGEETETKTKIAGKP
ISAETAKKTRDELKNVISGRNGTGKLYAIPGYDVAGKTGTSQIPDSKTGKYMTGAENYIF
SFLGMAPADNPELVIYVTMQQPQLSGSQTGGEAVSEVFNPVMKNSLQYMNIKPGDVEKLA
SEKVPVVAEKTVDEAKKAVQDKGLEPVVVGNGKKIVQQLPLANSEIMQGQKVILMTDGDM
TAPDMVNWSKVDALKVSEITGIPFEFSGNGYVKSQSVSAGSVINSETKMEITLASPEQIG
DFNQNHDQDTAEQNKKATDIRENAGIGDLLNE
Download sequence
Identical sequences Q929X8
gi|16801211|ref|NP_471479.1| WP_010991031.1.46653 272626.lin2145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]