SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42518894|ref|NP_964824.1| from Lactobacillus johnsonii NCC 533

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42518894|ref|NP_964824.1|
Domain Number 1 Region: 204-602
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.03e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.000000958
Further Details:      
 
Domain Number 2 Region: 65-253
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.7e-45
Family Penicillin binding protein dimerisation domain 0.0000303
Further Details:      
 
Domain Number 3 Region: 661-715
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0035
Further Details:      
 
Domain Number 4 Region: 603-658
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000942
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42518894|ref|NP_964824.1|
Sequence length 716
Comment penicillin-binding protein 2B [Lactobacillus johnsonii NCC 533]
Sequence
MKKFNNLNRNRSKAHGYRFTVGRILQLVLALVFLVFIGRFLYIGISNQVAGENLNKRVNQ
IYRRNEVLKATRGTIYDKNGLTLAEDAHVFTVYAILDKSSIDYHNKPMYVTNKRKTAQKL
AEVLPLSEEKIYSYLTPKHKAFQVEFGSAGTGLTLSQKERIEEMKLPGIKFIETPSRLYP
NGNFASHIIGLAQPKKNQGNSTLVGTMGIEAYFDKQLAGKDGYREAFVDAENYQLPNSQK
NARATKDGDNVYLTLDSRLQTYLEVLMSQVQDKYKPKALTAVVEDIKTGKILAASQRPTF
NPQTKKGLDTSWRNMLVQDSYEPGSVFKVLTYSSAIESGHYNPNEQYKSGAVTVQGSTIH
DWNNSGWGSIPFSQAFPRSSNVGFVKLEQKMGSKTWKEYLNKYRIGKKTGVTLPGETAGI
LNFSTPLNQAVTAFGQGVNVNAMQMMQAYSALANNGQMVKPQFVEKIVSPSGKVVEKFHR
TKVGTPIYSAKTAKTVLKGMQDVVNASYGTGAAYKMPGKSIAVKTGTAQIAGPHGGYLTG
DNNYIFSVVGVTPANNPRYCVYLTMKQPQKMSKPAETILSSIFKPIMNRLISLSDSSAKV
NEKVTVPALTGKSVEKAKEDANNAGVSVEVIGTGKNVSRQSVGAGVKEDTDTKIFLYTGG
KVTCPNMVGWSEDEVNSFMTTTDIPITINGKGKVTKQSIPAGKVIDKNSKLSVNLK
Download sequence
Identical sequences Q74JY7
257314.LJ0969 gi|42518894|ref|NP_964824.1| WP_011161840.1.27409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]