SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42519409|ref|NP_965339.1| from Lactobacillus johnsonii NCC 533

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42519409|ref|NP_965339.1|
Domain Number 1 Region: 8-283
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-83
Family Protein kinases, catalytic subunit 0.00000322
Further Details:      
 
Weak hits

Sequence:  gi|42519409|ref|NP_965339.1|
Domain Number - Region: 504-562
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00111
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Domain Number - Region: 425-479
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42519409|ref|NP_965339.1|
Sequence length 662
Comment hypothetical protein LJ1537 [Lactobacillus johnsonii NCC 533]
Sequence
MEKGHLLGGRYKIISVLGEGGMANVYLAEDIILQRKVAVKVLRLDLQKDPQTIQRFQREA
LSTSELSHPHIVSILDVGTDGNCHYLVMDYVDGSDLEEYIQHNNPIPLPKVIDIMDQILS
AVALAHKHNVIHRDLKPQNILMDKKGNIKIVDFGIAIALNQSTMTQTNTAMGSVHYMSPE
QARGSMATKQSDIYSLGIILYKLLTGTVPFTGENAVAVALKHFQEKTPSLRDKNPNVPQA
LENVVFKATAKDPRDRYKSALEMKADLDTCLDPKRKDEPIFKPEHDPSTDETIVVPPLEG
SVHNKDHEVQAKEEPKEEKKSLFKNLKGHTWWWLGAIIAFCVIMVILFFALGRKDMVDIP
NINRMSQTQAKKSLQSSNLKIGKITYEYSDSVPKGEVIRTDPPIGSQIKDGEKVNLVLSR
GSHLVEMPNVIGESYSLARKQLVKLGFTVTKTEEYSPSPKNQVNAQDIEPGQEVNPNKST
VTLLVSKGPSSASSTRSRRNTIKLRDIVGYSLKGARDYAREHHLSLKVEEEDSDGKNDGT
VLRQSPESGTDVNPGDRLTVVVAKAKRNDSTDTSSSSTTTTTVTKSYTINYPGSADQSGS
EKTPDHIQVYVSDDGHSINNIYKDMNITSEQTFTIPFKLSKKNGHIKILRNGETILDEDV
NK
Download sequence
Identical sequences Q74IN2
WP_011162261.1.27409 gi|42519409|ref|NP_965339.1| 257314.LJ1537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]