SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004160 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004160
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily dUTPase-like 1.3e-48
Family dUTPase-like 0.000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004160   Gene: ENSLAFG00000004976   Transcript: ENSLAFT00000004974
Sequence length 164
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_80:3184527:3198495:-1 gene:ENSLAFG00000004976 transcript:ENSLAFT00000004974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSEETPAISPSKRARPAEDGGPRLRFVRLSEHATAPTRGSARAAGYDLYSAYDYTVPA
MEKALVKTDIQIALPPGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEK
FEVKKGDRIAQLICERIFYPEIEEVQVLDDTKRGSGGFGSTGKN
Download sequence
Identical sequences G3SVA3
ENSLAFP00000004160 XP_003420194.1.64505 ENSLAFP00000004160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]