SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004782 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004782
Domain Number 1 Region: 25-61
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.000000000000327
Family Ribosomal protein L36 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004782   Gene: ENSLAFG00000005707   Transcript: ENSLAFT00000005705
Sequence length 61
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_7:10456706:10456888:1 gene:ENSLAFG00000005707 transcript:ENSLAFT00000005705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKPSLVIESLLSNHLMPRLQPALGLKTKVAIRRRCKDCYQVKRRGRWFIYCKTNPKHKQR
Q
Download sequence
Identical sequences G3SWR1
ENSLAFP00000004782 ENSLAFP00000004782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]