SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009625 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009625
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000301
Family Cgl1923-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009625   Gene: ENSLAFG00000011522   Transcript: ENSLAFT00000011521
Sequence length 264
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:98871365:98900241:1 gene:ENSLAFG00000011522 transcript:ENSLAFT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCVDPAPELTGFTLLMPAVSVGNVGQLAIDLIISTLNMFKVGYFYTDCLVPMVGNNP
YATTEENAAELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWIKSSNLARVIV
LSSSHSYHCNDLQLRSTPFRYLLTPSMQRSVQNKIKSLNWEEMEKSQCVPGIEDSEFCVR
IPGGGITKALYEESCSREIPVAILLKFVSEGDNIPDALGLVEYLNEWLQIIKPCVDAPTV
SALPWKIPSSWRFLFGSGLPPALF
Download sequence
Identical sequences G3T7N0
ENSLAFP00000009625 XP_003406439.1.64505 ENSLAFP00000009625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]