SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001818 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001818
Domain Number 1 Region: 522-555,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001818   Gene: ENSLAFG00000002173   Transcript: ENSLAFT00000002173
Sequence length 759
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:77622479:77653533:-1 gene:ENSLAFG00000002173 transcript:ENSLAFT00000002173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSKNAFGEEHKKKCRSHKTFLDHLKECFSCSSKKAKRIALSLFPI
ASWLPAYRIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPSYGLYAAFFPVIVYFFLG
TSKHISVGPFPVLSMMVGAVVVRIVPDISESAVEVPYNSTSNGTTLDEQRVLVAAAITVL
SGIIQLIMGVLQIGFVVIYLSDSLISGFTTAAAIHVLVSQLKFMLQLTVPAHTDPFSIFK
VLQSVFSQIEKTNIADLVTSLIILLVVFVVKEINQRYKAKLPVPIPIELIMTVIATGVSY
GFDFQNRFKVAVIGEMPSGFQAPVPPDVKVFQDTIGDCFAIAIVGFAVAFSVASVYSLKY
DYPIDGNQELIAFGLSNIVCGSFRGFASSTALSRSGVQESTGGKTQIAGILSAIIVLIVI
VAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIVTFICAIVLGLG
LGLAASIAFQLLTIVFRTQFPKCSTLANVGRSNIYKNRKDYYDTYEPEGVKIFRCPSPIY
FANIGFFKQKLIDAIGFSPLRILRKRNKALKKIRKLQKQGLLQVTPKGFICTVDGLKDSD
EELDNNQIEELDQPINTADLPFQIDWNSDLPVNIVVPKINLHSLILDFSAVSFLDISSMR
GLKTILRELLRIQVDVYIVGSDDDFIEKLTRCEFFDDEVTDSIFFLTTHDAVLHILMKKD
YSTSKFSHSQEKEMEHDFTINTNGGLRNRECQVPLETRF
Download sequence
Identical sequences G3SPZ0
ENSLAFP00000001818 ENSLAFP00000001818 XP_003407257.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]