SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003551 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003551
Domain Number 1 Region: 523-553,657-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000122
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003551   Gene: ENSLAFG00000004257   Transcript: ENSLAFT00000004259
Sequence length 788
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:10925073:10945228:-1 gene:ENSLAFG00000004257 transcript:ENSLAFT00000004259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGKKLRDAFRCSSAKIKTVVFGLFPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMEAARLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYVFGLTVPSYAGPGAIVFT
FIDICKNLPNTNMASLIFALISGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLSPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKNKLDCCVWVVSFLASFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVRETAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKKQEMGRKMPTQHKKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQKPTNGASVSYITFSPDTSSGAHCELPASAESPSDTLASVPPFVTFH
TLILDMSGVSFVDLMGIKALAKLGSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGGLER
SHIFPSIHDAVLFAQAGTRDVAPGHSFQGAPVDPELSLYDLEEDSPSYWNLEQEMFGSMF
HTETLTAL
Download sequence
Identical sequences G3STX1
XP_003410315.1.64505 ENSLAFP00000003551 ENSLAFP00000003551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]