SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004294 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004294
Domain Number 1 Region: 339-370,515-588
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000107
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004294   Gene: ENSLAFG00000005125   Transcript: ENSLAFT00000005128
Sequence length 741
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:129271994:129324143:1 gene:ENSLAFG00000005125 transcript:ENSLAFT00000005128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSMGVLGFGFIATYLPESVINAYLAATALHIMLSQLTCILGIVISFHAGPVAFFYNIIN
YCLSLPKANSTSILLFLTAVVALRINKCIKISFNRYPIEFPMEFLLIVGFTLIANKLSMA
TETSKTLVEMIPYSFLFPVIPDMDILSKVILQAISLALVSSSLLVFLGKKIAAVHNYRVN
SNQDLIAIGLCNVISSFFRCCVFTAAIARTVIQDKSGGRQQFASLVGAGVMLLLMVKVGH
FFYQLPNAVLAGVILSNVTPYLGTISNLPHLWRQDQYDCVIWLVTFSSAIFLGLDFGLLL
SVAFAFFIIAVRSHRAKIYLLGQIPNTNIYRSISDYREITNIPGVKIFQCCNSITFVNVY
QLKRRLLNEIDMIRVRLKEEEVFGLFTRCAHSGHTSREAERGCRCYCNCDEPEPPPRIAY
TERFERKLGHSSSTIHLVSCARFESVTTNQSTSDEQVPYTVSSTSQRNQGRNLEEEEKVW
VPNNPLRNSSPPLPDTTESQGRSRSLLPYSDVSLLPTTHTIILDFSMVHFVDSQASVILR
QMCNAFQNANILVLIAGCHSSVIRALERNDFFDTGITKAQLFLTLHDAVLFALSRKIPDS
SELSVDESETVIQETFSEKKKNEEPGYHMNNSNIEIPKNTNPGFRALIREPEVVEESELE
PTLESEQENELDLDLDLDLELEPESEPVPKSRPRVQTHSPQYRRSPYPSSQPQTQPWTRS
VERRHQHMDLHSSKGNDTKDP
Download sequence
Identical sequences G3SVL9
ENSLAFP00000004294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]