SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017581 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017581
Domain Number 1 Region: 434-823
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-133
Family Ankyrin repeat 0.000000000169
Further Details:      
 
Domain Number 2 Region: 197-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.28e-73
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 47-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-55
Family Ankyrin repeat 0.0000138
Further Details:      
 
Domain Number 4 Region: 4053-4163
Classification Level Classification E-value
Superfamily DEATH domain 1.71e-25
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017581   Gene: ENSLAFG00000023164   Transcript: ENSLAFT00000022603
Sequence length 4346
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:41378235:41699078:-1 gene:ENSLAFG00000023164 transcript:ENSLAFT00000022603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHIDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETVMTTTITEKHKMNVPETM
NEVLDMSDDEVHKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGQDLKELGDDSLPAEG
YMGFSLGARSAHLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLR
HYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRIT
CRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR
SENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIK
QESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSP
IVTVEPRRRKFHKPITMTIPVPPPSGEGVANGYKGDTTPNLRLLCSITGGTSPAQWEDIT
GTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMN
DPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQ
QLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKK
ETESDQDDETEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFLSTR
PYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSV
KSISDVASPIRSFRTISSPIKTVVSPSPYNIQVSSGTLVRPPTVTEAVPLKGLVSNSTFS
SRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSP
AKSTVDVISSAKVTMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATL
QEKISTATNSVSPVVNAATDTVEKVFSTTTAMPFSPLRSYVSSAPSAFQSLRTPSASALY
TSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTT
ETRPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQT
DVPEEKPFQTEPPKEGKIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGSPKSPKSDK
GHSPEDDWIEFSSEEIKEARQAAASHSPSLPERVQYNLTKVIDYLTNDIGSSSLTNLKYK
FEDAKKDGEERQKRILKPAIALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDTILESP
DDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEVVHV
IRSYEPSAGDVPQSQPEEPVSPKPSPTFMELEPKPTTSSIKEKVKAFQMKAGSEEDDHNQ
VLNKGMRVKEETHITTTTRMVYHSPPGSEGASERIEETMSVHDIMKAFQSGRDPSKELAG
LFEHKSAASPDIHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQAEPTEVIIRETKK
HPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAEESLPSYLESSRV
NTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESYRFAEKMLLSEK
LDVSHSDTEESVTDHAGTPSSELQGSDKWSREKVATAPKKEILSKIYKDVSENGVGKVSK
DEHFDKVTVLHYSGDVSSPKHAMWMRFTEDRLDRGREKFLYEDRVDRTVKEAEEKLTEVS
QFFRDKTEKLNDELQSPEKKPRPKNGKEYSSQSSSSSSPEKVLLMELLVSNDEWVKARQH
GHDGQGFPVAEERKASSLPSSPEKKVLSQQTEDGRSTVEDKESVSQSKAPEGPQSGFQLK
QSKLSSIKLKFEQGIHAKNKDISQEDKKPDGQSRIPVKKIQESKLPVYQVFAREKQQKAI
DLSDESVSVQKDFMILKTQDEHVQSDDIVVNDSVSDDVKKQRTEMSSKAMPDYFSEQQAT
DLACHVTSDLTTKGPWDKKVFRTWESSGATNNKSQKEKLSHVLIHDVRENHIAHPENKSV
DQKSEFMSVTEREHKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGERPGGSLDQPSRR
SESSAVSHIPVRVADERRMLSSNIPDGFCEQPTFPNHELSQKLPQSSMSKETIETQHFHS
VEDEKVTYAEISRFSKNQSYVGLCPPLDEIETSPTKSPDSLEFSPGKESPSSDVFDHSPI
DGLEKAAALAQTEGGKEIKSLPVYVSFVQVGKQYEKEIQQGSIKKIISQECKTVQETRGT
FYTTRQQKQTPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIA
YIPGKPSPIPEVSEESEEEEQAKSTSLKQPTVEEATTLEHEIPNDVSKDSNQRPKNNRVA
YIEFPPPPPLDADQMESDKHHYLPEKEIDMIEVNLLDEHDKYQLAEPVIRVQPPSPVPPG
ADISDSSDDESLYQPVPVKKYTFKLKEVDEEQKEMTKCKASAEKDSNQKDLETNGSGRDS
EFGLGLDSPQNETAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLTE
SDSKLPLQTMEIKKDVWNTEGILKPADRSFSQSKLEVIEEEGKVGPDEDKPPSKSSSSAK
TPDKTDQRSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNR
GDDEVFDSKSREDETKPLGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEGKMF
EMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMVTDTLQPQSGDTTVET
NLERNVETPTVEPTPRIPTSGECQEGTSSSGSLEKSAAATNTSKVDPKLRTPIKMGISAS
TMTLKKEGPGEVTDKLEAVMTSCQGLENETIMISSTANSQMGIRPQEKHDFQKDNFNNNN
NLDSSTIQTDNITSNVVLTEHSAPTCTTDKVNTVKSSSGKKTGVLQGHCLRETREMVGIR
RKSKLPIKATSPKDTFPPNHMPNIRTSKMKQVSSSEKTRALTTSPCVDVKSRIPVKSTHR
DNVASVRKACATHKQGQPEKGKAKQLPSKLPVKVRSTYVTTTTTTTTTTSTTTTTVKVRK
SQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQSELSDEEDSTSRNTSLSETSRGGQ
PSVTTKPARDKKTEAAPLKSKSEKAGSEKRNSPQSPCERTDIRMAIVADHLGLSWTELAR
ELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTAVLTKINRIDIVTLL
EGPIFDYGNISGTRSFADENNVFHDPVDGWQNETSSGNLESLAQARRVTGGLLDRLDDSP
DQCRDSITSYLKGEHGKFEANGSHAEATSEAKTKSYFSESQNDIGKQSAKETLKPKTHVS
GRVEEPPSPLAAYQKSLEESSKLVIEEPKPCVPVSMKKMSRTAPADGKPRLNLHHETLMR
TFLLKQGEGYKVKMKKEIRHVEKKSH
Download sequence
Identical sequences G3TQ10
ENSLAFP00000017581 ENSLAFP00000017581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]