SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019246 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019246
Domain Number 1 Region: 707-836,901-967
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.79e-39
Family Hemopexin-like domain 0.00086
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000288
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000889
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019246   Gene: ENSLAFG00000026653   Transcript: ENSLAFT00000028151
Sequence length 967
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:13756173:13773115:-1 gene:ENSLAFG00000026653 transcript:ENSLAFT00000028151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWKILPIYLLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDAACNCDYNCQYYMECCPDF
KKVCTVELSCKGRCFESFRRGRECDCDSECKKFGKCCPDYNSFCEKAHNPTSPPSSKTTP
PVPAASLNIRSATKRSPKSPNKTEKVIESQKITEEHYVSENQESSSSSSSSTRKIKSSQN
SAANSELKKKPKVKNNKKKKTPKKRPAPELPVVEEAGSGLDSDFKLAPTTYISTTQSNKV
TTPPKITSAKPINPKPSLLPNPNTSAVKVTSKETPSTASKETTAETEKTGTTNKQILTST
EETTSAKEIQSTEKTSAPTSEVPAKPTPKGETTTKAPSLTTTKEPTPTTTKESVLTIPKE
SVPTTPKXLSPTNPMTPTPTIPKVPVTTTPENPATTSAKEPAPTIPEEPASTIPKDLTPT
IPEEPTPATPETPAPTTSESSTLTITMEPPSTPTIPAKPTPELPAEPTSKSTEDSPKELA
VPITKAPEVAKPEMTTAPEITTAAPKMTTKKTTTTTEEKTTESKITSTTMQGTTITTEDT
TLAKTTLKATTTPQITTTTKKAMTTTEIKKPEETTAIPKDTATNSEVTTPKPQKPTKAPK
KPTSTKKPKTTPKVRKPKIRPTPSKMTTTMPELSPTSEATTSPNKAPNTEIIWTNPKNED
IGAAEGEKPHMILRPPVLRPTVISGIDSLVRPHQGISVNLMFSDETNLCNGIPVDGLTTL
RNGTLVAFRGHYFWMLSPFRPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYW
RFTNDIKDAGYPKQIVKGFGGLNGKIVAALSIARYKNRPESVYFFKRGGSVQQYTYKQEP
VQKCTGRRPAINYPVYREMIQIRRRRFERAIGPSQTHTIRIHYSPVRVTYQDKDFLHNEV
PVSTLWRGLPAVVTSAISLPNIRKPDGYDYYTFSKDQYYNIDVPSRTARAITTRSGQTLS
KVWYNCP
Download sequence
Identical sequences G3TUI8
ENSLAFP00000019246 ENSLAFP00000019246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]