SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019945 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019945
Domain Number 1 Region: 339-370,515-588
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019945   Gene: ENSLAFG00000005125   Transcript: ENSLAFT00000032444
Sequence length 745
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:129271994:129324152:1 gene:ENSLAFG00000005125 transcript:ENSLAFT00000032444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSMGVLGFGFIATYLPESVINAYLAATALHIMLSQLTCILGIVISFHAGPVAFFYNIIN
YCLSLPKANSTSILLFLTAVVALRINKCIKISFNRYPIEFPMEFLLIVGFTLIANKLSMA
TETSKTLVEMIPYSFLFPVIPDMDILSKVILQAISLALVSSSLLVFLGKKIAAVHNYRVN
SNQDLIAIGLCNVISSFFRCCVFTAAIARTVIQDKSGGRQQFASLVGAGVMLLLMVKVGH
FFYQLPNAVLAGVILSNVTPYLGTISNLPHLWRQDQYDCVIWLVTFSSAIFLGLDFGLLL
SVAFAFFIIAVRSHRAKIYLLGQIPNTNIYRSISDYREITNIPGVKIFQCCNSITFVNVY
QLKRRLLNEIDMIRVRLKEEEVFGLFTRCAHSGHTSREAERGCRCYCNCDEPEPPPRIAY
TERFERKLGHSSSTIHLVSCARFESVTTNQSTSDEQVPYTVSSTSQRNQGRNLEEEEKVW
VPNNPLRNSSPPLPDTTESQGRSRSLLPYSDVSLLPTTHTIILDFSMVHFVDSQASVILR
QMCNAFQNANILVLIAGCHSSVIRALERNDFFDTGITKAQLFLTLHDAVLFALSRKIPDS
SELSVDESETVIQETFSEKDKKNEEPGYHMNNSNIEIPKNTNPGFRALIREPEVVEESEL
EPTLESEQENELDLDLDLDLELEPESEPVPKSRPRVQTHSPQYRRSPYPSSQPQTQPWTR
SVERRHQHMDLHSSKGNDTKDPWEE
Download sequence
Identical sequences G3TWI7
ENSLAFP00000004294 ENSLAFP00000019945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]