SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021687 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021687
Domain Number 1 Region: 134-227
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 419-466
Classification Level Classification E-value
Superfamily Histone-fold 2.09e-17
Family TBP-associated factors, TAFs 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021687   Gene: ENSLAFG00000001807   Transcript: ENSLAFT00000035868
Sequence length 632
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_121:2082890:2125319:1 gene:ENSLAFG00000001807 transcript:ENSLAFT00000035868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPPVQISTVQAQGT
PIIARQVTPTTIIKQVSQAQTTVQPTTTLQRSPGMQPQLVLGGTAQTASLGTATAVQTGT
PQRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGK
IEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPAAQATTA
LTAVVLSSSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKPGQPTLLVWKSPGGIGSL
MRPPQVRLKGIYLALRQPHSRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSTVSAQAA
AAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFL
LPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKVSETAQQKNFSYKDDER
YEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKASAGQEDPEQLRLKQKAKEMQQ
QELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGSGPGTAVPGSSGVGTPRQFTRQ
RITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences G3U1H9
ENSLAFP00000021687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]