SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021964 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021964
Domain Number 1 Region: 254-346
Classification Level Classification E-value
Superfamily TAFH domain-like 1.57e-32
Family TAFH domain-like 0.0000359
Further Details:      
 
Domain Number 2 Region: 660-708
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000153
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021964   Gene: ENSLAFG00000000982   Transcript: ENSLAFT00000033642
Sequence length 868
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:75077479:75219382:-1 gene:ENSLAFG00000000982 transcript:ENSLAFT00000033642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLSEPAGAAPPAGVNVSGTVTMAPTGALPVRMENAPVALGAATKASVTVCMGSSASQ
PLRKAAPVGTLVTKVASVSAVPQVSGGPRLPAPQIVAAAKAPNTTVLLPANIQLPPGTVV
IKSNSGQLMLVSPQQALTRADTTSNVISRPAVPTNTQSIKTCLMPNSSSQLIKKVAMVPV
KKLAQTGTTVVTTVPKPSSVQSVPVPNNVVTVTPVKPLNTVPTLEASSFGVSPMPSSEPN
LKTESSAVAQTNLSPMMLENVKKCKNFLAMLIKLACGGSQSPEMGQNVQGLVEQLLDAKI
EAEEFTRKLYVELKSSPQPHLVPFLKKSVIALRQLIPNSQSFIQQCVQQTSSEAVIATCT
TTVTSSPVVTTASSVQSEKTVTVSGETAPRTVSVHIENPLAGPDGANTGVVTLHPVGPAA
IPGGTTAGTVLLQTSKPLVTSVPNTVTTVSLQPEKPVVSGAAVSLALPSVTFGETSAATI
CLPSMKPVVTFSGTTADKPVVDAPVQIRLAQPNSILSQPPGIPQAVKVKQLFALFHVVQQ
PSGGITKQVTTLSHSSALTIQKSGQKKMPVDTVISTSQFSPASVLKQITLPGNKVLSLQV
SPLQKTKIKENGTTSFRDEDDINDVTSMAGVNLNEEDACILATNSELVGTLIRSCKDEPF
LFIGALQKRILDIGKKHDITELNSDAVNLISCATQERLRGLLEKLTTIAQHRMTTYKTSE
NYILSSDTRSQLKFLEKLDQLEKERKDLEEREMLFKAAKSRSNKEDPEQLRLKQKAKELQ
QLELAQIQHRDANLTALAAIGPRKKRPLESGNEGIKDNLLASGTPSLTATKQLLRPRITR
VCLRDLIFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences G3U2A6
ENSLAFP00000021964 ENSLAFP00000000823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]