SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385237211|ref|YP_005798550.1| from Acinetobacter baumannii TCDC-AB0715

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385237211|ref|YP_005798550.1|
Domain Number 1 Region: 192-291
Classification Level Classification E-value
Superfamily TPR-like 0.000000000239
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385237211|ref|YP_005798550.1|
Sequence length 313
Comment hypothetical protein ABTW07_1661 [Acinetobacter baumannii TCDC-AB0715]
Sequence
MNFKPLAYILLATSSLTACTMAPVKEQKIEPFVFKEPELTPPFYALNPFNYDAPPAFEVA
LKEAAAQPVTKMVVTRQDDPTKTLTLDTNKLIVPTVNNSQRSMKYAVLAGNNEIDVTEID
DFLQLVEGKARHYPPRFTDRQERKGFESKLKEVTQRLDTLAANPDASFDILIRAFKASVL
ARNLDLGTAHTTKSLEYAQRLLKINPDDAEANFWFGFGLSEGGGQREAIPYLDKAIKGNV
QEAYLAAANNYIAMEQKKNAIQTLKNYKVKYPDEAEVADRLIQEIEKQGRWNVWQVLTNP
AMSSATPSAATKK
Download sequence
Identical sequences A0A009GUV0 A0A009HN55 A0A009RC69 A0A062DJY6 A0A062F947 A0A0E1PST2 A0A0R1BIE6 A0A1V3D6S8 G2JIX4
gi|384142907|ref|YP_005525617.1| gi|387124222|ref|YP_006290104.1| gi|469821637|ref|YP_007596007.1| gi|184157820|ref|YP_001846159.1| gi|384131915|ref|YP_005514527.1| gi|523523642|ref|YP_008209721.1| gi|523526909|ref|YP_008212940.1| WP_001009742.1.100119 WP_001009742.1.100136 WP_001009742.1.100157 WP_001009742.1.100211 WP_001009742.1.100222 WP_001009742.1.100238 WP_001009742.1.100290 WP_001009742.1.1003 WP_001009742.1.100380 WP_001009742.1.100406 WP_001009742.1.100568 WP_001009742.1.10058 WP_001009742.1.100616 WP_001009742.1.100656 WP_001009742.1.100957 WP_001009742.1.100971 WP_001009742.1.101001 WP_001009742.1.101005 WP_001009742.1.101012 WP_001009742.1.101037 WP_001009742.1.101100 WP_001009742.1.101243 WP_001009742.1.101254 WP_001009742.1.101258 WP_001009742.1.101276 WP_001009742.1.10136 WP_001009742.1.1014 WP_001009742.1.101413 WP_001009742.1.10147 WP_001009742.1.101515 WP_001009742.1.101574 WP_001009742.1.101742 WP_001009742.1.101810 WP_001009742.1.101885 WP_001009742.1.101910 WP_001009742.1.101976 WP_001009742.1.101995 WP_001009742.1.102023 WP_001009742.1.102110 WP_001009742.1.10256 WP_001009742.1.10328 WP_001009742.1.10375 WP_001009742.1.10466 WP_001009742.1.10512 WP_001009742.1.10649 WP_001009742.1.10725 WP_001009742.1.10768 WP_001009742.1.10777 WP_001009742.1.1080 WP_001009742.1.10838 WP_001009742.1.10909 WP_001009742.1.11003 WP_001009742.1.1101 WP_001009742.1.11016 WP_001009742.1.11090 WP_001009742.1.11203 WP_001009742.1.11307 WP_001009742.1.11308 WP_001009742.1.11374 WP_001009742.1.1138 WP_001009742.1.1155 WP_001009742.1.11698 WP_001009742.1.11910 WP_001009742.1.11923 WP_001009742.1.11924 WP_001009742.1.11925 WP_001009742.1.11926 WP_001009742.1.11989 WP_001009742.1.1216 WP_001009742.1.12250 WP_001009742.1.12322 WP_001009742.1.12414 WP_001009742.1.12529 WP_001009742.1.12617 WP_001009742.1.12638 WP_001009742.1.1270 WP_001009742.1.12702 WP_001009742.1.12796 WP_001009742.1.12818 WP_001009742.1.1283 WP_001009742.1.12837 WP_001009742.1.12912 WP_001009742.1.12974 WP_001009742.1.13047 WP_001009742.1.13078 WP_001009742.1.13137 WP_001009742.1.1317 WP_001009742.1.13195 WP_001009742.1.13220 WP_001009742.1.13236 WP_001009742.1.13485 WP_001009742.1.13516 WP_001009742.1.13521 WP_001009742.1.13596 WP_001009742.1.13616 WP_001009742.1.13651 WP_001009742.1.13699 WP_001009742.1.13761 WP_001009742.1.13821 WP_001009742.1.13871 WP_001009742.1.13894 WP_001009742.1.1390 WP_001009742.1.13916 WP_001009742.1.1396 WP_001009742.1.14020 WP_001009742.1.1411 WP_001009742.1.14187 WP_001009742.1.14271 WP_001009742.1.14311 WP_001009742.1.14354 WP_001009742.1.14357 WP_001009742.1.14385 WP_001009742.1.14392 WP_001009742.1.14479 WP_001009742.1.14515 WP_001009742.1.14650 WP_001009742.1.14700 WP_001009742.1.14801 WP_001009742.1.14829 WP_001009742.1.14853 WP_001009742.1.14854 WP_001009742.1.14909 WP_001009742.1.14939 WP_001009742.1.15152 WP_001009742.1.15166 WP_001009742.1.15289 WP_001009742.1.15383 WP_001009742.1.15462 WP_001009742.1.15465 WP_001009742.1.15497 WP_001009742.1.15651 WP_001009742.1.15653 WP_001009742.1.15656 WP_001009742.1.15695 WP_001009742.1.15778 WP_001009742.1.15793 WP_001009742.1.15821 WP_001009742.1.15947 WP_001009742.1.16011 WP_001009742.1.16178 WP_001009742.1.16202 WP_001009742.1.16325 WP_001009742.1.16371 WP_001009742.1.1639 WP_001009742.1.16411 WP_001009742.1.16434 WP_001009742.1.16510 WP_001009742.1.1656 WP_001009742.1.16576 WP_001009742.1.16579 WP_001009742.1.1658 WP_001009742.1.16607 WP_001009742.1.16610 WP_001009742.1.16699 WP_001009742.1.16717 WP_001009742.1.16864 WP_001009742.1.16993 WP_001009742.1.17021 WP_001009742.1.17244 WP_001009742.1.17433 WP_001009742.1.17468 WP_001009742.1.17492 WP_001009742.1.17632 WP_001009742.1.17646 WP_001009742.1.17664 WP_001009742.1.17752 WP_001009742.1.17781 WP_001009742.1.17999 WP_001009742.1.18082 WP_001009742.1.18091 WP_001009742.1.18238 WP_001009742.1.18246 WP_001009742.1.18302 WP_001009742.1.18325 WP_001009742.1.18385 WP_001009742.1.18546 WP_001009742.1.18755 WP_001009742.1.1910 WP_001009742.1.19120 WP_001009742.1.19131 WP_001009742.1.1916 WP_001009742.1.19168 WP_001009742.1.19292 WP_001009742.1.19339 WP_001009742.1.19396 WP_001009742.1.19475 WP_001009742.1.19531 WP_001009742.1.19670 WP_001009742.1.19826 WP_001009742.1.19877 WP_001009742.1.1995 WP_001009742.1.20044 WP_001009742.1.20120 WP_001009742.1.20176 WP_001009742.1.20194 WP_001009742.1.20306 WP_001009742.1.2033 WP_001009742.1.20359 WP_001009742.1.2039 WP_001009742.1.20444 WP_001009742.1.20534 WP_001009742.1.20541 WP_001009742.1.20656 WP_001009742.1.20748 WP_001009742.1.20807 WP_001009742.1.20816 WP_001009742.1.20817 WP_001009742.1.20830 WP_001009742.1.20889 WP_001009742.1.20998 WP_001009742.1.21032 WP_001009742.1.21112 WP_001009742.1.21117 WP_001009742.1.21190 WP_001009742.1.21264 WP_001009742.1.21337 WP_001009742.1.21484 WP_001009742.1.21546 WP_001009742.1.21662 WP_001009742.1.21689 WP_001009742.1.21738 WP_001009742.1.21747 WP_001009742.1.21939 WP_001009742.1.22047 WP_001009742.1.22053 WP_001009742.1.22108 WP_001009742.1.22209 WP_001009742.1.22216 WP_001009742.1.22286 WP_001009742.1.22301 WP_001009742.1.22349 WP_001009742.1.22396 WP_001009742.1.22452 WP_001009742.1.22469 WP_001009742.1.22515 WP_001009742.1.22586 WP_001009742.1.22687 WP_001009742.1.23023 WP_001009742.1.23141 WP_001009742.1.23173 WP_001009742.1.23188 WP_001009742.1.23234 WP_001009742.1.23243 WP_001009742.1.23328 WP_001009742.1.23401 WP_001009742.1.23636 WP_001009742.1.23651 WP_001009742.1.23669 WP_001009742.1.2386 WP_001009742.1.23975 WP_001009742.1.23997 WP_001009742.1.24015 WP_001009742.1.24041 WP_001009742.1.24097 WP_001009742.1.24105 WP_001009742.1.24152 WP_001009742.1.24178 WP_001009742.1.24260 WP_001009742.1.24358 WP_001009742.1.24373 WP_001009742.1.24449 WP_001009742.1.2445 WP_001009742.1.24545 WP_001009742.1.24611 WP_001009742.1.24621 WP_001009742.1.24706 WP_001009742.1.24744 WP_001009742.1.24750 WP_001009742.1.24927 WP_001009742.1.25091 WP_001009742.1.25143 WP_001009742.1.25263 WP_001009742.1.25292 WP_001009742.1.25478 WP_001009742.1.25519 WP_001009742.1.25524 WP_001009742.1.25560 WP_001009742.1.2559 WP_001009742.1.2561 WP_001009742.1.25689 WP_001009742.1.25723 WP_001009742.1.2585 WP_001009742.1.25850 WP_001009742.1.25971 WP_001009742.1.26181 WP_001009742.1.26204 WP_001009742.1.2626 WP_001009742.1.26352 WP_001009742.1.26425 WP_001009742.1.26436 WP_001009742.1.26472 WP_001009742.1.26504 WP_001009742.1.26528 WP_001009742.1.26647 WP_001009742.1.26649 WP_001009742.1.26669 WP_001009742.1.26678 WP_001009742.1.26715 WP_001009742.1.26744 WP_001009742.1.26946 WP_001009742.1.27059 WP_001009742.1.27109 WP_001009742.1.27176 WP_001009742.1.27265 WP_001009742.1.27270 WP_001009742.1.273 WP_001009742.1.2730 WP_001009742.1.27346 WP_001009742.1.2736 WP_001009742.1.2738 WP_001009742.1.27506 WP_001009742.1.27509 WP_001009742.1.2762 WP_001009742.1.2769 WP_001009742.1.27704 WP_001009742.1.27731 WP_001009742.1.27801 WP_001009742.1.27845 WP_001009742.1.27852 WP_001009742.1.27934 WP_001009742.1.27983 WP_001009742.1.28048 WP_001009742.1.28101 WP_001009742.1.28141 WP_001009742.1.28204 WP_001009742.1.28320 WP_001009742.1.28385 WP_001009742.1.28405 WP_001009742.1.28411 WP_001009742.1.28456 WP_001009742.1.28507 WP_001009742.1.28513 WP_001009742.1.28601 WP_001009742.1.28677 WP_001009742.1.28774 WP_001009742.1.28883 WP_001009742.1.28898 WP_001009742.1.28929 WP_001009742.1.28937 WP_001009742.1.28988 WP_001009742.1.29074 WP_001009742.1.29117 WP_001009742.1.29123 WP_001009742.1.29216 WP_001009742.1.29229 WP_001009742.1.29347 WP_001009742.1.29362 WP_001009742.1.29434 WP_001009742.1.29455 WP_001009742.1.29552 WP_001009742.1.2979 WP_001009742.1.29806 WP_001009742.1.29817 WP_001009742.1.29824 WP_001009742.1.29897 WP_001009742.1.30026 WP_001009742.1.30083 WP_001009742.1.30161 WP_001009742.1.30309 WP_001009742.1.30407 WP_001009742.1.30490 WP_001009742.1.30611 WP_001009742.1.30667 WP_001009742.1.30673 WP_001009742.1.3075 WP_001009742.1.30776 WP_001009742.1.30856 WP_001009742.1.30932 WP_001009742.1.30969 WP_001009742.1.30978 WP_001009742.1.30996 WP_001009742.1.31141 WP_001009742.1.3116 WP_001009742.1.31328 WP_001009742.1.31430 WP_001009742.1.3144 WP_001009742.1.3162 WP_001009742.1.3163 WP_001009742.1.31729 WP_001009742.1.31810 WP_001009742.1.31834 WP_001009742.1.3198 WP_001009742.1.31980 WP_001009742.1.32028 WP_001009742.1.32065 WP_001009742.1.32129 WP_001009742.1.32257 WP_001009742.1.32272 WP_001009742.1.32304 WP_001009742.1.32374 WP_001009742.1.32386 WP_001009742.1.32487 WP_001009742.1.32579 WP_001009742.1.32682 WP_001009742.1.32773 WP_001009742.1.3280 WP_001009742.1.32830 WP_001009742.1.32845 WP_001009742.1.32847 WP_001009742.1.32956 WP_001009742.1.3303 WP_001009742.1.33104 WP_001009742.1.33154 WP_001009742.1.33198 WP_001009742.1.33262 WP_001009742.1.33370 WP_001009742.1.33386 WP_001009742.1.33447 WP_001009742.1.3346 WP_001009742.1.33495 WP_001009742.1.33541 WP_001009742.1.33558 WP_001009742.1.33679 WP_001009742.1.33706 WP_001009742.1.33714 WP_001009742.1.33777 WP_001009742.1.33805 WP_001009742.1.33869 WP_001009742.1.33902 WP_001009742.1.33929 WP_001009742.1.33931 WP_001009742.1.33978 WP_001009742.1.33999 WP_001009742.1.34027 WP_001009742.1.34045 WP_001009742.1.34049 WP_001009742.1.34077 WP_001009742.1.34207 WP_001009742.1.34394 WP_001009742.1.34618 WP_001009742.1.34642 WP_001009742.1.34859 WP_001009742.1.35000 WP_001009742.1.35018 WP_001009742.1.35046 WP_001009742.1.35242 WP_001009742.1.35250 WP_001009742.1.35327 WP_001009742.1.3535 WP_001009742.1.35461 WP_001009742.1.35558 WP_001009742.1.35588 WP_001009742.1.35601 WP_001009742.1.35715 WP_001009742.1.35717 WP_001009742.1.35728 WP_001009742.1.35758 WP_001009742.1.35761 WP_001009742.1.35828 WP_001009742.1.35883 WP_001009742.1.35912 WP_001009742.1.36327 WP_001009742.1.36355 WP_001009742.1.36358 WP_001009742.1.36359 WP_001009742.1.36418 WP_001009742.1.36517 WP_001009742.1.36549 WP_001009742.1.36569 WP_001009742.1.36694 WP_001009742.1.36714 WP_001009742.1.36735 WP_001009742.1.36866 WP_001009742.1.36869 WP_001009742.1.36882 WP_001009742.1.36909 WP_001009742.1.36938 WP_001009742.1.37007 WP_001009742.1.3712 WP_001009742.1.37215 WP_001009742.1.37437 WP_001009742.1.3758 WP_001009742.1.37603 WP_001009742.1.37680 WP_001009742.1.37729 WP_001009742.1.37893 WP_001009742.1.37963 WP_001009742.1.37982 WP_001009742.1.38009 WP_001009742.1.38122 WP_001009742.1.38249 WP_001009742.1.38320 WP_001009742.1.3837 WP_001009742.1.3843 WP_001009742.1.3861 WP_001009742.1.38628 WP_001009742.1.38696 WP_001009742.1.38732 WP_001009742.1.38748 WP_001009742.1.38779 WP_001009742.1.38901 WP_001009742.1.38964 WP_001009742.1.39019 WP_001009742.1.39353 WP_001009742.1.39399 WP_001009742.1.39598 WP_001009742.1.39680 WP_001009742.1.39688 WP_001009742.1.397 WP_001009742.1.3974 WP_001009742.1.39911 WP_001009742.1.39927 WP_001009742.1.39928 WP_001009742.1.40199 WP_001009742.1.40200 WP_001009742.1.40225 WP_001009742.1.40233 WP_001009742.1.40297 WP_001009742.1.40332 WP_001009742.1.4047 WP_001009742.1.40490 WP_001009742.1.40547 WP_001009742.1.40645 WP_001009742.1.40679 WP_001009742.1.40832 WP_001009742.1.40836 WP_001009742.1.4086 WP_001009742.1.40864 WP_001009742.1.40947 WP_001009742.1.41029 WP_001009742.1.41059 WP_001009742.1.4110 WP_001009742.1.41201 WP_001009742.1.41266 WP_001009742.1.41395 WP_001009742.1.41425 WP_001009742.1.41507 WP_001009742.1.41546 WP_001009742.1.4164 WP_001009742.1.41720 WP_001009742.1.41738 WP_001009742.1.41777 WP_001009742.1.41838 WP_001009742.1.41922 WP_001009742.1.41934 WP_001009742.1.41936 WP_001009742.1.42080 WP_001009742.1.42172 WP_001009742.1.42253 WP_001009742.1.42289 WP_001009742.1.42351 WP_001009742.1.42401 WP_001009742.1.42484 WP_001009742.1.42531 WP_001009742.1.42561 WP_001009742.1.42571 WP_001009742.1.42708 WP_001009742.1.42765 WP_001009742.1.4277 WP_001009742.1.42773 WP_001009742.1.4281 WP_001009742.1.42824 WP_001009742.1.42888 WP_001009742.1.42928 WP_001009742.1.43011 WP_001009742.1.43028 WP_001009742.1.43094 WP_001009742.1.431 WP_001009742.1.4311 WP_001009742.1.43175 WP_001009742.1.43194 WP_001009742.1.43203 WP_001009742.1.43227 WP_001009742.1.43340 WP_001009742.1.43380 WP_001009742.1.43439 WP_001009742.1.43641 WP_001009742.1.43645 WP_001009742.1.43751 WP_001009742.1.43755 WP_001009742.1.43759 WP_001009742.1.4396 WP_001009742.1.43978 WP_001009742.1.44009 WP_001009742.1.4426 WP_001009742.1.44275 WP_001009742.1.44342 WP_001009742.1.44370 WP_001009742.1.44372 WP_001009742.1.44407 WP_001009742.1.44538 WP_001009742.1.44613 WP_001009742.1.44664 WP_001009742.1.44684 WP_001009742.1.44770 WP_001009742.1.44809 WP_001009742.1.44816 WP_001009742.1.44926 WP_001009742.1.44929 WP_001009742.1.44944 WP_001009742.1.44974 WP_001009742.1.44991 WP_001009742.1.45149 WP_001009742.1.45233 WP_001009742.1.45291 WP_001009742.1.45350 WP_001009742.1.4537 WP_001009742.1.45399 WP_001009742.1.45418 WP_001009742.1.45457 WP_001009742.1.45587 WP_001009742.1.45608 WP_001009742.1.45637 WP_001009742.1.45647 WP_001009742.1.45675 WP_001009742.1.45761 WP_001009742.1.45839 WP_001009742.1.45916 WP_001009742.1.46108 WP_001009742.1.46138 WP_001009742.1.46194 WP_001009742.1.46246 WP_001009742.1.46255 WP_001009742.1.46258 WP_001009742.1.46338 WP_001009742.1.46385 WP_001009742.1.46392 WP_001009742.1.46413 WP_001009742.1.46474 WP_001009742.1.4648 WP_001009742.1.46493 WP_001009742.1.46518 WP_001009742.1.46577 WP_001009742.1.46739 WP_001009742.1.46762 WP_001009742.1.46774 WP_001009742.1.46827 WP_001009742.1.4683 WP_001009742.1.46850 WP_001009742.1.46918 WP_001009742.1.46950 WP_001009742.1.46959 WP_001009742.1.47241 WP_001009742.1.47298 WP_001009742.1.4733 WP_001009742.1.47388 WP_001009742.1.47515 WP_001009742.1.47543 WP_001009742.1.47552 WP_001009742.1.47573 WP_001009742.1.47715 WP_001009742.1.47816 WP_001009742.1.47828 WP_001009742.1.47863 WP_001009742.1.47903 WP_001009742.1.47917 WP_001009742.1.48042 WP_001009742.1.48115 WP_001009742.1.4819 WP_001009742.1.4824 WP_001009742.1.48270 WP_001009742.1.48280 WP_001009742.1.48380 WP_001009742.1.48415 WP_001009742.1.48457 WP_001009742.1.48495 WP_001009742.1.48509 WP_001009742.1.48529 WP_001009742.1.48642 WP_001009742.1.48692 WP_001009742.1.48700 WP_001009742.1.48717 WP_001009742.1.48785 WP_001009742.1.48824 WP_001009742.1.4887 WP_001009742.1.489 WP_001009742.1.48925 WP_001009742.1.48988 WP_001009742.1.49083 WP_001009742.1.4911 WP_001009742.1.49261 WP_001009742.1.49318 WP_001009742.1.4935 WP_001009742.1.49380 WP_001009742.1.49405 WP_001009742.1.4941 WP_001009742.1.49564 WP_001009742.1.49639 WP_001009742.1.4967 WP_001009742.1.49705 WP_001009742.1.49789 WP_001009742.1.49849 WP_001009742.1.49866 WP_001009742.1.49896 WP_001009742.1.49928 WP_001009742.1.49960 WP_001009742.1.49992 WP_001009742.1.50011 WP_001009742.1.50097 WP_001009742.1.50208 WP_001009742.1.50223 WP_001009742.1.50267 WP_001009742.1.50298 WP_001009742.1.503 WP_001009742.1.50617 WP_001009742.1.50641 WP_001009742.1.50705 WP_001009742.1.50789 WP_001009742.1.50815 WP_001009742.1.50851 WP_001009742.1.50859 WP_001009742.1.50867 WP_001009742.1.50872 WP_001009742.1.51063 WP_001009742.1.51303 WP_001009742.1.51328 WP_001009742.1.51369 WP_001009742.1.51437 WP_001009742.1.51569 WP_001009742.1.51578 WP_001009742.1.51597 WP_001009742.1.51620 WP_001009742.1.51640 WP_001009742.1.51663 WP_001009742.1.5171 WP_001009742.1.51856 WP_001009742.1.51861 WP_001009742.1.5193 WP_001009742.1.51966 WP_001009742.1.52032 WP_001009742.1.5206 WP_001009742.1.52103 WP_001009742.1.52138 WP_001009742.1.52189 WP_001009742.1.5220 WP_001009742.1.52325 WP_001009742.1.52392 WP_001009742.1.52445 WP_001009742.1.52619 WP_001009742.1.52644 WP_001009742.1.5274 WP_001009742.1.52769 WP_001009742.1.52779 WP_001009742.1.5281 WP_001009742.1.52837 WP_001009742.1.52839 WP_001009742.1.52840 WP_001009742.1.52885 WP_001009742.1.52980 WP_001009742.1.52982 WP_001009742.1.53023 WP_001009742.1.53052 WP_001009742.1.53097 WP_001009742.1.53146 WP_001009742.1.53331 WP_001009742.1.53390 WP_001009742.1.53424 WP_001009742.1.53498 WP_001009742.1.53533 WP_001009742.1.53593 WP_001009742.1.53616 WP_001009742.1.53708 WP_001009742.1.53762 WP_001009742.1.53854 WP_001009742.1.53954 WP_001009742.1.54 WP_001009742.1.54055 WP_001009742.1.54088 WP_001009742.1.5412 WP_001009742.1.54139 WP_001009742.1.54242 WP_001009742.1.54266 WP_001009742.1.54352 WP_001009742.1.54361 WP_001009742.1.54451 WP_001009742.1.54566 WP_001009742.1.54581 WP_001009742.1.54664 WP_001009742.1.54741 WP_001009742.1.54761 WP_001009742.1.5489 WP_001009742.1.54906 WP_001009742.1.54963 WP_001009742.1.54977 WP_001009742.1.55062 WP_001009742.1.55096 WP_001009742.1.55155 WP_001009742.1.55201 WP_001009742.1.55321 WP_001009742.1.55363 WP_001009742.1.55368 WP_001009742.1.55376 WP_001009742.1.55516 WP_001009742.1.55638 WP_001009742.1.55773 WP_001009742.1.55799 WP_001009742.1.55952 WP_001009742.1.55997 WP_001009742.1.56027 WP_001009742.1.56067 WP_001009742.1.56076 WP_001009742.1.56102 WP_001009742.1.56165 WP_001009742.1.56211 WP_001009742.1.56246 WP_001009742.1.56379 WP_001009742.1.56538 WP_001009742.1.56668 WP_001009742.1.56712 WP_001009742.1.56717 WP_001009742.1.56798 WP_001009742.1.56833 WP_001009742.1.56841 WP_001009742.1.5697 WP_001009742.1.56991 WP_001009742.1.57078 WP_001009742.1.57346 WP_001009742.1.57408 WP_001009742.1.57457 WP_001009742.1.57465 WP_001009742.1.57535 WP_001009742.1.57543 WP_001009742.1.57606 WP_001009742.1.57654 WP_001009742.1.5769 WP_001009742.1.5780 WP_001009742.1.57829 WP_001009742.1.57874 WP_001009742.1.58061 WP_001009742.1.58115 WP_001009742.1.58159 WP_001009742.1.5822 WP_001009742.1.58269 WP_001009742.1.58337 WP_001009742.1.58453 WP_001009742.1.58506 WP_001009742.1.58621 WP_001009742.1.58969 WP_001009742.1.590 WP_001009742.1.59078 WP_001009742.1.5908 WP_001009742.1.59107 WP_001009742.1.59325 WP_001009742.1.59416 WP_001009742.1.59476 WP_001009742.1.59488 WP_001009742.1.59522 WP_001009742.1.5961 WP_001009742.1.59649 WP_001009742.1.59754 WP_001009742.1.59765 WP_001009742.1.59897 WP_001009742.1.59957 WP_001009742.1.600 WP_001009742.1.60059 WP_001009742.1.60099 WP_001009742.1.60108 WP_001009742.1.60116 WP_001009742.1.60176 WP_001009742.1.60198 WP_001009742.1.60243 WP_001009742.1.60299 WP_001009742.1.60316 WP_001009742.1.60318 WP_001009742.1.60359 WP_001009742.1.60474 WP_001009742.1.60581 WP_001009742.1.60589 WP_001009742.1.60609 WP_001009742.1.60616 WP_001009742.1.60655 WP_001009742.1.60669 WP_001009742.1.60697 WP_001009742.1.61105 WP_001009742.1.6112 WP_001009742.1.61291 WP_001009742.1.61336 WP_001009742.1.61410 WP_001009742.1.61441 WP_001009742.1.61452 WP_001009742.1.61477 WP_001009742.1.61527 WP_001009742.1.61578 WP_001009742.1.61637 WP_001009742.1.61704 WP_001009742.1.61974 WP_001009742.1.62011 WP_001009742.1.62067 WP_001009742.1.62150 WP_001009742.1.62191 WP_001009742.1.62308 WP_001009742.1.62368 WP_001009742.1.624 WP_001009742.1.62428 WP_001009742.1.62543 WP_001009742.1.6257 WP_001009742.1.62712 WP_001009742.1.62767 WP_001009742.1.6277 WP_001009742.1.62868 WP_001009742.1.62924 WP_001009742.1.62935 WP_001009742.1.63028 WP_001009742.1.63219 WP_001009742.1.63252 WP_001009742.1.63274 WP_001009742.1.63303 WP_001009742.1.63340 WP_001009742.1.63391 WP_001009742.1.63405 WP_001009742.1.63426 WP_001009742.1.63429 WP_001009742.1.6352 WP_001009742.1.63609 WP_001009742.1.63636 WP_001009742.1.63639 WP_001009742.1.63681 WP_001009742.1.63857 WP_001009742.1.63933 WP_001009742.1.64129 WP_001009742.1.64214 WP_001009742.1.64218 WP_001009742.1.64310 WP_001009742.1.64428 WP_001009742.1.64465 WP_001009742.1.64604 WP_001009742.1.64639 WP_001009742.1.64761 WP_001009742.1.64834 WP_001009742.1.64907 WP_001009742.1.64955 WP_001009742.1.64964 WP_001009742.1.65003 WP_001009742.1.65005 WP_001009742.1.65058 WP_001009742.1.6513 WP_001009742.1.6519 WP_001009742.1.65267 WP_001009742.1.65325 WP_001009742.1.65342 WP_001009742.1.65373 WP_001009742.1.65496 WP_001009742.1.65560 WP_001009742.1.65584 WP_001009742.1.65592 WP_001009742.1.65630 WP_001009742.1.65680 WP_001009742.1.65804 WP_001009742.1.65866 WP_001009742.1.65890 WP_001009742.1.65939 WP_001009742.1.65955 WP_001009742.1.65995 WP_001009742.1.66140 WP_001009742.1.66142 WP_001009742.1.66189 WP_001009742.1.66200 WP_001009742.1.66210 WP_001009742.1.66215 WP_001009742.1.66431 WP_001009742.1.66458 WP_001009742.1.66491 WP_001009742.1.66496 WP_001009742.1.66541 WP_001009742.1.66591 WP_001009742.1.66636 WP_001009742.1.66689 WP_001009742.1.66716 WP_001009742.1.66717 WP_001009742.1.66782 WP_001009742.1.66806 WP_001009742.1.66899 WP_001009742.1.67009 WP_001009742.1.67361 WP_001009742.1.67426 WP_001009742.1.67486 WP_001009742.1.67500 WP_001009742.1.67597 WP_001009742.1.67601 WP_001009742.1.67656 WP_001009742.1.6767 WP_001009742.1.67728 WP_001009742.1.67862 WP_001009742.1.67869 WP_001009742.1.67895 WP_001009742.1.67922 WP_001009742.1.67939 WP_001009742.1.68024 WP_001009742.1.68065 WP_001009742.1.68087 WP_001009742.1.68119 WP_001009742.1.68132 WP_001009742.1.68168 WP_001009742.1.6820 WP_001009742.1.68225 WP_001009742.1.68315 WP_001009742.1.6841 WP_001009742.1.68428 WP_001009742.1.68454 WP_001009742.1.6851 WP_001009742.1.6861 WP_001009742.1.68698 WP_001009742.1.68830 WP_001009742.1.68837 WP_001009742.1.68858 WP_001009742.1.68885 WP_001009742.1.689 WP_001009742.1.68930 WP_001009742.1.69117 WP_001009742.1.69121 WP_001009742.1.69172 WP_001009742.1.69193 WP_001009742.1.69242 WP_001009742.1.69257 WP_001009742.1.69364 WP_001009742.1.69379 WP_001009742.1.69419 WP_001009742.1.69424 WP_001009742.1.69478 WP_001009742.1.6952 WP_001009742.1.69568 WP_001009742.1.69586 WP_001009742.1.6962 WP_001009742.1.69665 WP_001009742.1.69815 WP_001009742.1.69929 WP_001009742.1.69930 WP_001009742.1.70025 WP_001009742.1.70154 WP_001009742.1.70197 WP_001009742.1.70283 WP_001009742.1.70354 WP_001009742.1.70542 WP_001009742.1.70827 WP_001009742.1.70891 WP_001009742.1.71151 WP_001009742.1.71168 WP_001009742.1.71204 WP_001009742.1.71220 WP_001009742.1.71335 WP_001009742.1.71413 WP_001009742.1.71435 WP_001009742.1.71539 WP_001009742.1.71650 WP_001009742.1.71719 WP_001009742.1.71796 WP_001009742.1.71823 WP_001009742.1.71825 WP_001009742.1.71857 WP_001009742.1.71876 WP_001009742.1.71960 WP_001009742.1.71969 WP_001009742.1.71971 WP_001009742.1.72084 WP_001009742.1.7213 WP_001009742.1.72158 WP_001009742.1.72265 WP_001009742.1.72295 WP_001009742.1.72317 WP_001009742.1.72334 WP_001009742.1.72356 WP_001009742.1.72430 WP_001009742.1.7244 WP_001009742.1.72538 WP_001009742.1.72997 WP_001009742.1.73076 WP_001009742.1.73146 WP_001009742.1.73238 WP_001009742.1.73341 WP_001009742.1.73348 WP_001009742.1.73375 WP_001009742.1.73434 WP_001009742.1.73446 WP_001009742.1.73542 WP_001009742.1.73645 WP_001009742.1.73699 WP_001009742.1.73727 WP_001009742.1.73806 WP_001009742.1.73867 WP_001009742.1.73875 WP_001009742.1.73932 WP_001009742.1.74122 WP_001009742.1.74312 WP_001009742.1.74424 WP_001009742.1.74463 WP_001009742.1.7453 WP_001009742.1.74700 WP_001009742.1.74709 WP_001009742.1.74711 WP_001009742.1.74819 WP_001009742.1.74838 WP_001009742.1.74869 WP_001009742.1.74930 WP_001009742.1.75104 WP_001009742.1.75105 WP_001009742.1.75107 WP_001009742.1.75121 WP_001009742.1.7521 WP_001009742.1.75212 WP_001009742.1.75225 WP_001009742.1.75386 WP_001009742.1.75412 WP_001009742.1.75459 WP_001009742.1.75489 WP_001009742.1.75562 WP_001009742.1.75569 WP_001009742.1.75738 WP_001009742.1.75812 WP_001009742.1.75859 WP_001009742.1.75890 WP_001009742.1.75895 WP_001009742.1.75939 WP_001009742.1.76026 WP_001009742.1.7606 WP_001009742.1.76101 WP_001009742.1.76117 WP_001009742.1.76250 WP_001009742.1.76260 WP_001009742.1.76372 WP_001009742.1.76464 WP_001009742.1.76493 WP_001009742.1.76523 WP_001009742.1.76587 WP_001009742.1.7662 WP_001009742.1.76682 WP_001009742.1.76698 WP_001009742.1.76787 WP_001009742.1.76809 WP_001009742.1.76871 WP_001009742.1.76953 WP_001009742.1.76981 WP_001009742.1.77226 WP_001009742.1.77237 WP_001009742.1.77257 WP_001009742.1.77274 WP_001009742.1.77347 WP_001009742.1.77539 WP_001009742.1.7757 WP_001009742.1.77634 WP_001009742.1.77711 WP_001009742.1.77758 WP_001009742.1.77787 WP_001009742.1.77815 WP_001009742.1.77891 WP_001009742.1.77903 WP_001009742.1.7791 WP_001009742.1.77996 WP_001009742.1.78042 WP_001009742.1.78154 WP_001009742.1.7816 WP_001009742.1.78240 WP_001009742.1.7825 WP_001009742.1.78261 WP_001009742.1.78263 WP_001009742.1.78355 WP_001009742.1.78505 WP_001009742.1.7864 WP_001009742.1.7866 WP_001009742.1.78660 WP_001009742.1.78769 WP_001009742.1.78783 WP_001009742.1.78805 WP_001009742.1.78808 WP_001009742.1.78988 WP_001009742.1.79010 WP_001009742.1.79028 WP_001009742.1.79072 WP_001009742.1.79078 WP_001009742.1.7908 WP_001009742.1.79181 WP_001009742.1.79229 WP_001009742.1.79260 WP_001009742.1.79261 WP_001009742.1.79284 WP_001009742.1.793 WP_001009742.1.79328 WP_001009742.1.7938 WP_001009742.1.79405 WP_001009742.1.7949 WP_001009742.1.79567 WP_001009742.1.79701 WP_001009742.1.79720 WP_001009742.1.79728 WP_001009742.1.79736 WP_001009742.1.79774 WP_001009742.1.7978 WP_001009742.1.79889 WP_001009742.1.79909 WP_001009742.1.79938 WP_001009742.1.80092 WP_001009742.1.80121 WP_001009742.1.80125 WP_001009742.1.80143 WP_001009742.1.80162 WP_001009742.1.80195 WP_001009742.1.8021 WP_001009742.1.80665 WP_001009742.1.80730 WP_001009742.1.80766 WP_001009742.1.80887 WP_001009742.1.80897 WP_001009742.1.80987 WP_001009742.1.80997 WP_001009742.1.81002 WP_001009742.1.81068 WP_001009742.1.81161 WP_001009742.1.81240 WP_001009742.1.81253 WP_001009742.1.81319 WP_001009742.1.81345 WP_001009742.1.81373 WP_001009742.1.81412 WP_001009742.1.81441 WP_001009742.1.81466 WP_001009742.1.81700 WP_001009742.1.81704 WP_001009742.1.81764 WP_001009742.1.82039 WP_001009742.1.82040 WP_001009742.1.82082 WP_001009742.1.82090 WP_001009742.1.82110 WP_001009742.1.82203 WP_001009742.1.82235 WP_001009742.1.82286 WP_001009742.1.8230 WP_001009742.1.82366 WP_001009742.1.82371 WP_001009742.1.82453 WP_001009742.1.82504 WP_001009742.1.82538 WP_001009742.1.82561 WP_001009742.1.82786 WP_001009742.1.828 WP_001009742.1.82809 WP_001009742.1.82848 WP_001009742.1.83001 WP_001009742.1.8301 WP_001009742.1.8312 WP_001009742.1.83178 WP_001009742.1.83400 WP_001009742.1.83410 WP_001009742.1.83450 WP_001009742.1.83474 WP_001009742.1.83594 WP_001009742.1.836 WP_001009742.1.83693 WP_001009742.1.8377 WP_001009742.1.838 WP_001009742.1.83889 WP_001009742.1.83896 WP_001009742.1.83970 WP_001009742.1.84012 WP_001009742.1.84058 WP_001009742.1.84139 WP_001009742.1.84171 WP_001009742.1.84173 WP_001009742.1.84247 WP_001009742.1.84250 WP_001009742.1.84308 WP_001009742.1.84332 WP_001009742.1.84387 WP_001009742.1.84447 WP_001009742.1.84490 WP_001009742.1.84527 WP_001009742.1.84536 WP_001009742.1.84550 WP_001009742.1.84571 WP_001009742.1.84618 WP_001009742.1.84663 WP_001009742.1.84688 WP_001009742.1.84691 WP_001009742.1.84706 WP_001009742.1.8472 WP_001009742.1.84769 WP_001009742.1.84864 WP_001009742.1.84898 WP_001009742.1.84921 WP_001009742.1.84944 WP_001009742.1.85149 WP_001009742.1.85158 WP_001009742.1.85168 WP_001009742.1.85185 WP_001009742.1.85299 WP_001009742.1.85364 WP_001009742.1.85468 WP_001009742.1.85472 WP_001009742.1.85493 WP_001009742.1.85544 WP_001009742.1.85616 WP_001009742.1.85711 WP_001009742.1.85716 WP_001009742.1.85743 WP_001009742.1.85833 WP_001009742.1.85846 WP_001009742.1.85889 WP_001009742.1.85922 WP_001009742.1.8596 WP_001009742.1.8601 WP_001009742.1.86100 WP_001009742.1.86131 WP_001009742.1.86163 WP_001009742.1.86242 WP_001009742.1.86277 WP_001009742.1.86324 WP_001009742.1.86385 WP_001009742.1.86536 WP_001009742.1.86715 WP_001009742.1.86890 WP_001009742.1.86908 WP_001009742.1.86922 WP_001009742.1.86966 WP_001009742.1.86973 WP_001009742.1.86976 WP_001009742.1.87048 WP_001009742.1.87099 WP_001009742.1.87111 WP_001009742.1.87156 WP_001009742.1.87312 WP_001009742.1.87545 WP_001009742.1.87567 WP_001009742.1.87598 WP_001009742.1.87688 WP_001009742.1.87717 WP_001009742.1.87727 WP_001009742.1.87746 WP_001009742.1.87830 WP_001009742.1.88109 WP_001009742.1.88115 WP_001009742.1.88131 WP_001009742.1.88133 WP_001009742.1.88163 WP_001009742.1.88183 WP_001009742.1.88512 WP_001009742.1.88596 WP_001009742.1.8860 WP_001009742.1.88613 WP_001009742.1.88654 WP_001009742.1.88842 WP_001009742.1.88956 WP_001009742.1.89172 WP_001009742.1.89199 WP_001009742.1.89209 WP_001009742.1.89218 WP_001009742.1.89289 WP_001009742.1.89376 WP_001009742.1.89383 WP_001009742.1.89419 WP_001009742.1.89459 WP_001009742.1.89484 WP_001009742.1.89568 WP_001009742.1.89611 WP_001009742.1.89653 WP_001009742.1.89685 WP_001009742.1.89790 WP_001009742.1.89792 WP_001009742.1.89836 WP_001009742.1.89876 WP_001009742.1.89878 WP_001009742.1.89906 WP_001009742.1.9 WP_001009742.1.90087 WP_001009742.1.90118 WP_001009742.1.90132 WP_001009742.1.90262 WP_001009742.1.90310 WP_001009742.1.90375 WP_001009742.1.90378 WP_001009742.1.9038 WP_001009742.1.90413 WP_001009742.1.90656 WP_001009742.1.90697 WP_001009742.1.90704 WP_001009742.1.90743 WP_001009742.1.90755 WP_001009742.1.90781 WP_001009742.1.90932 WP_001009742.1.90945 WP_001009742.1.90953 WP_001009742.1.91061 WP_001009742.1.91085 WP_001009742.1.91147 WP_001009742.1.91206 WP_001009742.1.91249 WP_001009742.1.91286 WP_001009742.1.91335 WP_001009742.1.9134 WP_001009742.1.91355 WP_001009742.1.91477 WP_001009742.1.91502 WP_001009742.1.91523 WP_001009742.1.9154 WP_001009742.1.91696 WP_001009742.1.9172 WP_001009742.1.91762 WP_001009742.1.91780 WP_001009742.1.91789 WP_001009742.1.91854 WP_001009742.1.91908 WP_001009742.1.91941 WP_001009742.1.91998 WP_001009742.1.92112 WP_001009742.1.92179 WP_001009742.1.9228 WP_001009742.1.9233 WP_001009742.1.92365 WP_001009742.1.92417 WP_001009742.1.92687 WP_001009742.1.92711 WP_001009742.1.92749 WP_001009742.1.92830 WP_001009742.1.92945 WP_001009742.1.92998 WP_001009742.1.9309 WP_001009742.1.93094 WP_001009742.1.93114 WP_001009742.1.93151 WP_001009742.1.9316 WP_001009742.1.93280 WP_001009742.1.93451 WP_001009742.1.93580 WP_001009742.1.93594 WP_001009742.1.93682 WP_001009742.1.93778 WP_001009742.1.93796 WP_001009742.1.93849 WP_001009742.1.93868 WP_001009742.1.93948 WP_001009742.1.93991 WP_001009742.1.94015 WP_001009742.1.94034 WP_001009742.1.94144 WP_001009742.1.94265 WP_001009742.1.94387 WP_001009742.1.94410 WP_001009742.1.94725 WP_001009742.1.94740 WP_001009742.1.94826 WP_001009742.1.94900 WP_001009742.1.94948 WP_001009742.1.95026 WP_001009742.1.95040 WP_001009742.1.95092 WP_001009742.1.95109 WP_001009742.1.95111 WP_001009742.1.95220 WP_001009742.1.95260 WP_001009742.1.95269 WP_001009742.1.95270 WP_001009742.1.9536 WP_001009742.1.95539 WP_001009742.1.95622 WP_001009742.1.95653 WP_001009742.1.95665 WP_001009742.1.95755 WP_001009742.1.95844 WP_001009742.1.95859 WP_001009742.1.95873 WP_001009742.1.95923 WP_001009742.1.9593 WP_001009742.1.96029 WP_001009742.1.96046 WP_001009742.1.962 WP_001009742.1.96323 WP_001009742.1.9645 WP_001009742.1.96530 WP_001009742.1.96556 WP_001009742.1.96598 WP_001009742.1.96696 WP_001009742.1.96747 WP_001009742.1.96930 WP_001009742.1.96942 WP_001009742.1.96998 WP_001009742.1.97032 WP_001009742.1.9714 WP_001009742.1.97163 WP_001009742.1.9733 WP_001009742.1.97520 WP_001009742.1.97709 WP_001009742.1.97710 WP_001009742.1.97780 WP_001009742.1.97844 WP_001009742.1.97893 WP_001009742.1.97920 WP_001009742.1.9794 WP_001009742.1.98004 WP_001009742.1.98007 WP_001009742.1.98068 WP_001009742.1.98150 WP_001009742.1.98224 WP_001009742.1.98272 WP_001009742.1.9832 WP_001009742.1.98354 WP_001009742.1.98434 WP_001009742.1.98523 WP_001009742.1.98561 WP_001009742.1.98625 WP_001009742.1.98691 WP_001009742.1.98692 WP_001009742.1.987 WP_001009742.1.98806 WP_001009742.1.98835 WP_001009742.1.98919 WP_001009742.1.98950 WP_001009742.1.98965 WP_001009742.1.98968 WP_001009742.1.98986 WP_001009742.1.98998 WP_001009742.1.99048 WP_001009742.1.99049 WP_001009742.1.99077 WP_001009742.1.99120 WP_001009742.1.99162 WP_001009742.1.99188 WP_001009742.1.99206 WP_001009742.1.99250 WP_001009742.1.99391 WP_001009742.1.99449 WP_001009742.1.99464 WP_001009742.1.9952 WP_001009742.1.99555 WP_001009742.1.99653 WP_001009742.1.99775 WP_001009742.1.99825 WP_001009742.1.99833 WP_001009742.1.99868 WP_001009742.1.99931 WP_001009742.1.99964 WP_001009742.1.9997 gi|385237211|ref|YP_005798550.1| 405416.ACICU_01500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]