SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385238183|ref|YP_005799522.1| from Acinetobacter baumannii TCDC-AB0715

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385238183|ref|YP_005799522.1|
Domain Number 1 Region: 296-452
Classification Level Classification E-value
Superfamily TPR-like 0.000000607
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385238183|ref|YP_005799522.1|
Sequence length 475
Comment putative Zn-dependent protease [Acinetobacter baumannii TCDC-AB0715]
Sequence
MPVILSLALITNASYANPFDPKPASGQVEIPNIGSGIGLLDQQKEKFIGEKVFREVHKQM
SVIQDVWLEDQFFQVFSNILSETQLGQPIALVVIKDPQINAFAVPGGLFALNTGLISSAR
NIDEIAGVMAHEIAHVSQRHFSRSEEAFKGQTLLSLAGLLAGVALAAQAGGDAGAAVMLG
TQAALLDKQLTYSRNQEREADRIGMQYMYAAGYNPQSMADYFETMHRATSRVSFLPDFWL
THPLTSERMSEARLRANQMPKVKSRIYDVDFEILKWYTMVVAGEATENQLQSLASQKNLA
GLLALSAFYLKQGDYTQAQATLEQAKSSGKPLVALIQTDIYLGQNKLDQAYNSIAPLQMT
MPENKAFSYKLAEVLLRQGKYAQVQTLVQRFINKNARDIQGWQLLQQAANLDKNSPLRAV
NVLRYRAEAQYWSGSEEDAIKSMLHAQRLAKGNQAMSARIDSRLKQMQDERRMKI
Download sequence
Identical sequences A0A237W4D9
WP_002000697.1.100119 WP_002000697.1.100211 WP_002000697.1.100616 WP_002000697.1.100971 WP_002000697.1.101243 WP_002000697.1.10328 WP_002000697.1.1080 WP_002000697.1.10909 WP_002000697.1.1101 WP_002000697.1.11307 WP_002000697.1.11308 WP_002000697.1.1138 WP_002000697.1.12974 WP_002000697.1.13220 WP_002000697.1.13236 WP_002000697.1.13699 WP_002000697.1.1390 WP_002000697.1.14311 WP_002000697.1.14357 WP_002000697.1.14637 WP_002000697.1.14939 WP_002000697.1.15152 WP_002000697.1.16579 WP_002000697.1.16607 WP_002000697.1.17999 WP_002000697.1.18091 WP_002000697.1.18302 WP_002000697.1.18325 WP_002000697.1.18385 WP_002000697.1.19292 WP_002000697.1.19670 WP_002000697.1.20044 WP_002000697.1.20120 WP_002000697.1.20359 WP_002000697.1.20541 WP_002000697.1.20656 WP_002000697.1.21546 WP_002000697.1.21738 WP_002000697.1.21939 WP_002000697.1.22687 WP_002000697.1.23188 WP_002000697.1.23636 WP_002000697.1.23651 WP_002000697.1.24097 WP_002000697.1.24260 WP_002000697.1.24358 WP_002000697.1.24449 WP_002000697.1.24621 WP_002000697.1.24744 WP_002000697.1.25263 WP_002000697.1.25292 WP_002000697.1.25560 WP_002000697.1.26669 WP_002000697.1.27059 WP_002000697.1.27270 WP_002000697.1.2736 WP_002000697.1.27509 WP_002000697.1.28677 WP_002000697.1.28929 WP_002000697.1.29074 WP_002000697.1.29362 WP_002000697.1.29434 WP_002000697.1.29552 WP_002000697.1.30026 WP_002000697.1.30161 WP_002000697.1.30978 WP_002000697.1.31141 WP_002000697.1.32272 WP_002000697.1.32304 WP_002000697.1.32386 WP_002000697.1.32773 WP_002000697.1.3280 WP_002000697.1.33869 WP_002000697.1.33999 WP_002000697.1.35558 WP_002000697.1.35912 WP_002000697.1.36358 WP_002000697.1.36359 WP_002000697.1.36909 WP_002000697.1.36938 WP_002000697.1.3837 WP_002000697.1.3861 WP_002000697.1.38964 WP_002000697.1.39019 WP_002000697.1.39399 WP_002000697.1.40864 WP_002000697.1.41266 WP_002000697.1.41546 WP_002000697.1.41777 WP_002000697.1.41838 WP_002000697.1.42765 WP_002000697.1.43194 WP_002000697.1.43751 WP_002000697.1.43755 WP_002000697.1.44991 WP_002000697.1.45350 WP_002000697.1.46246 WP_002000697.1.46774 WP_002000697.1.46827 WP_002000697.1.4683 WP_002000697.1.47298 WP_002000697.1.48988 WP_002000697.1.4911 WP_002000697.1.49992 WP_002000697.1.50223 WP_002000697.1.50641 WP_002000697.1.50851 WP_002000697.1.50867 WP_002000697.1.50872 WP_002000697.1.51303 WP_002000697.1.51861 WP_002000697.1.52769 WP_002000697.1.52779 WP_002000697.1.52837 WP_002000697.1.53097 WP_002000697.1.53331 WP_002000697.1.54361 WP_002000697.1.54741 WP_002000697.1.55638 WP_002000697.1.55952 WP_002000697.1.56067 WP_002000697.1.56668 WP_002000697.1.57465 WP_002000697.1.5769 WP_002000697.1.5780 WP_002000697.1.58506 WP_002000697.1.59522 WP_002000697.1.60176 WP_002000697.1.60299 WP_002000697.1.61452 WP_002000697.1.62011 WP_002000697.1.62191 WP_002000697.1.62368 WP_002000697.1.6257 WP_002000697.1.62935 WP_002000697.1.63252 WP_002000697.1.63429 WP_002000697.1.63609 WP_002000697.1.63681 WP_002000697.1.64129 WP_002000697.1.65342 WP_002000697.1.65592 WP_002000697.1.66491 WP_002000697.1.66899 WP_002000697.1.68930 WP_002000697.1.69242 WP_002000697.1.69424 WP_002000697.1.69568 WP_002000697.1.69930 WP_002000697.1.70354 WP_002000697.1.70827 WP_002000697.1.71168 WP_002000697.1.71650 WP_002000697.1.71796 WP_002000697.1.71960 WP_002000697.1.72084 WP_002000697.1.72317 WP_002000697.1.72356 WP_002000697.1.73146 WP_002000697.1.74424 WP_002000697.1.74838 WP_002000697.1.75738 WP_002000697.1.76809 WP_002000697.1.77787 WP_002000697.1.77815 WP_002000697.1.77891 WP_002000697.1.7791 WP_002000697.1.78042 WP_002000697.1.78263 WP_002000697.1.79261 WP_002000697.1.7938 WP_002000697.1.79938 WP_002000697.1.80121 WP_002000697.1.80997 WP_002000697.1.82039 WP_002000697.1.82082 WP_002000697.1.82453 WP_002000697.1.82786 WP_002000697.1.84058 WP_002000697.1.84308 WP_002000697.1.85472 WP_002000697.1.85716 WP_002000697.1.86536 WP_002000697.1.86976 WP_002000697.1.87545 WP_002000697.1.87688 WP_002000697.1.88109 WP_002000697.1.88956 WP_002000697.1.89209 WP_002000697.1.89218 WP_002000697.1.89878 WP_002000697.1.90697 WP_002000697.1.91355 WP_002000697.1.91789 WP_002000697.1.91998 WP_002000697.1.92112 WP_002000697.1.92687 WP_002000697.1.92711 WP_002000697.1.92830 WP_002000697.1.9316 WP_002000697.1.93580 WP_002000697.1.93991 WP_002000697.1.94144 WP_002000697.1.95220 WP_002000697.1.95923 WP_002000697.1.96747 WP_002000697.1.97710 WP_002000697.1.98004 WP_002000697.1.98150 WP_002000697.1.98224 WP_002000697.1.98354 WP_002000697.1.98523 WP_002000697.1.98692 WP_002000697.1.987 WP_002000697.1.99120 WP_002000697.1.99206 WP_002000697.1.99825 WP_002000697.1.99868 WP_002000697.1.9997 gi|384131199|ref|YP_005513811.1| gi|385238183|ref|YP_005799522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]