SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375133966|ref|YP_004994616.1| from Acinetobacter calcoaceticus PHEA-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375133966|ref|YP_004994616.1|
Domain Number 1 Region: 2-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.28e-108
Family FMN-linked oxidoreductases 0.00000000816
Further Details:      
 
Domain Number 2 Region: 334-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.88e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000202
Further Details:      
 
Domain Number 3 Region: 471-630
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000106
Family C-terminal domain of adrenodoxin reductase-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375133966|ref|YP_004994616.1|
Sequence length 676
Comment 2,4-dienoyl-CoA reductase [Acinetobacter calcoaceticus PHEA-2]
Sequence
MTSYANLLKPLHLGFTTIKNRVVMGSMHTGLEDRFYNYPKLAAYFEERAKGGVGLIVTGG
ISPNRQGWLAPAGGTMNSLFDIPQHRLVTHAVHKHGSKILMQILHAGRYGYQPFVVSSTA
IKSPISPFKPRQLSEKNILSTIEDYAQCADIAKKAGYDGVEIMGSEGYLINQFLSRHVNQ
RTDRWGGEIENRMRFPVEIVKAIRAKVGEKFIICFRLSLLDLVHDGNTMQEVVTVAKALE
KAGVTLLNTGIGWHEARVPTIVTSVPRAAFVDYTAHVKQHISIPIIASNRINMPETAEEI
LATGKADMVQMARPLLADAFWVNKTATNRVDEINTCIACNQACLDHAFKNKRVSCLVNPR
AGHETELVYLKTKQPKRIAVVGGGVAGMSAATVAASRGHAVTLFEATSDVGGQFNFAKVV
PGKEEFHETIRYFKVQLEKTGVDVRLNTRVNREQLEREGFDEVIVATGVIPRVLKIEGSD
APQVLSYAQVLKGAEVGQKVAVIGAGGIGFDVSEFLLKPPHQPQPQPLADWQREWGVDPD
PNYVSEGGMQPPEVEPAIREIYLLQRKTTPLGIGLGKTSGWVHRAQLKKHGVRMLRGVQY
KAVTDEGLWIEHNGQDQLLRVDTVVVCAGQESVKDLMPKEGESTIANYHIIGGAKLAAEL
DAKRAIKEGAELAAQL
Download sequence
Identical sequences F0KHI6
YP_004994616.1.55679 gi|375133966|ref|YP_004994616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]