SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|153974|gww1.5.665.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|153974|gww1.5.665.1
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Ribosomal protein L1 0.0000000000196
Family Ribosomal protein L1 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|153974|gww1.5.665.1
Sequence length 130
Sequence
DRNKELVKKLAKEYDTFLASETLMKQIPQLFSLGLSQILSFSPFILANKIMEVRSTIKFX
SSRKLCAWTTIGCLGSQQHHTEYVSSFCHLGYMLTMLLGINFLVSLLKKNYWIIKLLHIK
TTMGDPVHHY
Download sequence
Identical sequences 29883.JGI153974 jgi|Lacbi1|153974|gww1.5.665.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]