SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|230477|e_gwh1.3.611.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|230477|e_gwh1.3.611.1
Domain Number 1 Region: 30-241
Classification Level Classification E-value
Superfamily Ribosomal protein L1 9.03e-40
Family Ribosomal protein L1 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|230477|e_gwh1.3.611.1
Sequence length 321
Sequence
MAKDELIDSKVSLKQCRLAVEALHSHESKRLEKLQETELLPGKEQNIWLNVTVKKIPSGH
KFKPIKIPIIHPLVDPRTTPVCLITKDPQRQYKDLLESHEIKFISRVVGVEKLKGKFKPF
EARRALLKENGLFLADERVIPLLPKLLGTKWFEAKKQPIPVCLTRKDLKGELERAISSTY
MNQNQGTCTSIKVSSLSHKPAQVLANIQSAIPAVVKHIKGGWDNVQSFNIKTNSSVSLPI
WSCRLDGEEGGRWDGFAAEDEQSDDEDKEKDSGEEEEMEVDDDSTKTKKGAKKSGLKRAT
SSDEEEEEEKPRKKSKGVKGT
Download sequence
Identical sequences B0CX82
jgi|Lacbi1|230477|e_gwh1.3.611.1 29883.JGI230477 XP_001876125.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]