SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|294417|estExt_fgenesh2_pg.C_120270 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|294417|estExt_fgenesh2_pg.C_120270
Domain Number 1 Region: 23-219
Classification Level Classification E-value
Superfamily Ribosomal protein L1 8.37e-65
Family Ribosomal protein L1 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|294417|estExt_fgenesh2_pg.C_120270
Sequence length 219
Sequence
MSASKLSVSSVRGSIKELLADANGEKKRNFVETIELQIGLKNYDPQRDKRFSGTVKLPNV
PRPRMSLCILADAADIDRAKQIELEYMSVDDLKKLNKNKKLVKKLAKKYDAFLASETLIK
QIPRLLGPGLSKAGKFPTPVSNAEDLSNKITEVRSTIKFQLKKVLCLGVAVGHVQMTDDQ
VLGNVMLSINFLVSLLKKNWQNIKSLHIKTTMGKPVRLY
Download sequence
Identical sequences B0DAX3
29883.JGI294417 XP_001881352.1.58555 jgi|Lacbi1|294417|estExt_fgenesh2_pg.C_120270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]