SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|299573|eu2.Lbscf0017g00270 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|299573|eu2.Lbscf0017g00270
Domain Number 1 Region: 22-69
Classification Level Classification E-value
Superfamily AF1782-like 0.0000327
Family AF1782-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|299573|eu2.Lbscf0017g00270
Sequence length 321
Sequence
MSQPLDPRRYSSKSKRPASIPELTEQALNNLQWDENEDIKHYLRVAGNYRRDGKEFVRTG
ELENAFVQLTRAAILVLEKLPLHRDYYTLLSPAQRQNLGLVRVYQLSGLGAFGCIMLLED
YRSHLTGSARQISYDAMPEILGLPHGKSRNFVPCSVTWFGMDGGTGLTSTHDLYGLFNSF
NGQDMLDTLGDLKPTLVDRFDKWIQAHPDGIDNERTPDANLPHPMPNDAQTQASAAQYHE
EEQRREQRRLAAEEAARWRRQREEQEELTERTRKDAVAAARQAANAPQRSATRDGESDRE
RERVFERERLRLRALALSMEE
Download sequence
Identical sequences B0DEW3
29883.JGI299573 jgi|Lacbi1|299573|eu2.Lbscf0017g00270 XP_001882462.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]