SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|301256|eu2.Lbscf0001g07050 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|301256|eu2.Lbscf0001g07050
Domain Number 1 Region: 58-284
Classification Level Classification E-value
Superfamily Ribosomal protein L1 6.41e-39
Family Ribosomal protein L1 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|301256|eu2.Lbscf0001g07050
Sequence length 287
Sequence
MLSLLSRQCKHSPKNALAQLRLFTTSQILLARRHQQPKIRVPSKKALAAKARRRAGIAAK
ADDRTQKLTLLEAIAVLRAVEVASPNSIYELLVKTEIKNGVAVPKGRVNLPREAKPSAEE
KILVFAEGRQAEEAKKAGAHIVGGPELIDGILSNRVRATTILCTTSLIRTITPKLGRFLG
PLGLMPSERRGTVTDDIAGYIQRIHGTSEWRADRAGSIRAPIATMQFPIEDVVKNVRHFL
TSVRRVTGNSRDADNERRGKASGAPVTKISKVMLSSRQGPGIRISDF
Download sequence
Identical sequences B0CRQ7
29883.JGI301256 jgi|Lacbi1|301256|eu2.Lbscf0001g07050 XP_001873449.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]