SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|314110|eu2.Lbscf0005g06990 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lacbi1|314110|eu2.Lbscf0005g06990
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily Ribosomal protein L1 0.00235
Family Ribosomal protein L1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|314110|eu2.Lbscf0005g06990
Sequence length 61
Sequence
MSFFWNNSMTLTYHQVEQALSVKRAGLDTGAACQHNTENKHNFVETFELWIGLKNYDPKR
D
Download sequence
Identical sequences B0D1L9
XP_001877560.1.58555 29883.JGI314110 jgi|Lacbi1|314110|eu2.Lbscf0005g06990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]