SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|329430|fgenesh3_pg.C_scaffold_21000147 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lacbi1|329430|fgenesh3_pg.C_scaffold_21000147
Domain Number - Region: 143-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000127
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|329430|fgenesh3_pg.C_scaffold_21000147
Sequence length 311
Sequence
MYASLFNSEAFLAATLFFERLIQKEEHVCTLIKTCQDDPTLSLDLHLILEAVATEKRLES
KLGYKDENVLSLHHMVTTAIAAAIRHGILNTIRDCDKLPAIPDYIPSHFAGRGIIQYFEK
FDAEIHSYGKKFPTSPRITAYHPYRRTPTPRCSKCKKMGHIRKNCSDYQCGGCLWWGPGH
TTPNCETKKKSDKAWEWEKNMRPAGYDTTTGTQMWKKKTYDWTGVPILRNEDWYTPRKQP
EFVDLTSPSPPSSPPFSPSMPPLAPPTPPSSPLYNPYSPTTHPSPLFDLEDLVSDFDSVT
SSSGNIGDIEV
Download sequence
Identical sequences B0DHZ8
XP_001883596.1.58555 jgi|Lacbi1|329430|fgenesh3_pg.C_scaffold_21000147 29883.JGI329430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]