SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|21181|gw1.16.130.1 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|21181|gw1.16.130.1
Domain Number 1 Region: 243-547
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.53e-67
Family Mitochondrial carrier 0.00012
Further Details:      
 
Domain Number 2 Region: 87-171
Classification Level Classification E-value
Superfamily EF-hand 1.3e-16
Family Calmodulin-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|21181|gw1.16.130.1
Sequence length 552
Sequence
PRPTLAQFRASEGPEARAAKLRALWTSLPNLPQLTDGPSALQRMKLPGQDTRTALSPQRA
ERLKKLYEEELVRRVRENRPNAFWEGFRRFLWDQEKELWDIFQELDKNGDGRLDAHEMRA
ALSRSGIDITQTTVDDLVRFLASGSDMYITFAEFRDFLIMLPRKATPFEIYKYYQVKKRY
SDGRGAARVDKEGDMSVSFPKPQAESLGAASATLFGHPKKDENSEGLEDEVEEDFGDAEV
QEDRHEAWRFLLAGGVAGAVSRTVTAPFDRLKIYLITTDHQYVNLRAVSASALRHPLAVG
STAVNNLWGAVTRIYVDGGGIKAFWVGNGLNVLKIFPESAIKFVSYEQSKKFLAQYWDKV
SDASELSSSSRFLAGGVGGITSQFAIYGLETLKTRVQSEMGPAQGWRAVLRTAGDMWRIG
GVRAYYRGLTLGLVGVFPYSAIDMGTYETLKKAYVKSTGKEEPSVFATLSFGALSGSIGA
ASVYPINLLRTRLQAAGSTGHKHSYTGFRDVLRQTLAHEGWRGLYKGLLPSILKVGPAVG
VSWIVYEDAKRR
Download sequence
Identical sequences R7SA76
XP_007007872.1.33187 jgi|Treme1|21181|gw1.16.130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]