SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|28071|e_gw1.2.415.1 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Treme1|28071|e_gw1.2.415.1
Domain Number - Region: 316-365
Classification Level Classification E-value
Superfamily EF-hand 0.00104
Family Calmodulin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|28071|e_gw1.2.415.1
Sequence length 368
Sequence
MVRVQYLLKQRKADNQPIRTRQADKYSDADPEFLALTNRQRAAIDRAFDRGLATISQRNQ
RHEKRRRIDPTFSEHDEEGYIVETSKQDVRSDEQEEGGFIPDDEGGFLDEAEGGFLPEDD
ERMGSPSPDLILDTDNPSISENNQTARVPLHLLPTLLTSLGLPSDSDVLSVFRSSASGWD
AEFDADSRRRKRGEEEAGVERKDFRAVCAALMGPDENEQDLGSEDEEAADAFTLPDDSDS
SLSPISSESSYGGRRTSKGKQKATEEDRPAKGRRKKLEMNGPVKLSTQQKEAVRDIWEML
KPPGEQGKRGHAANILGEEEVKKWARALGEMWSEDELSEMVTLFSTQHEQRGLSFDDFSA
VMLRAGLV
Download sequence
Identical sequences jgi|Treme1|28071|e_gw1.2.415.1 XP_007002418.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]