SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|30780|e_gw1.5.4.1 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|30780|e_gw1.5.4.1
Domain Number 1 Region: 1321-1449,1482-1692
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-37
Family p120GAP domain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 636-791
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-36
Family Calponin-homology domain, CH-domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 1911-2009
Classification Level Classification E-value
Superfamily RGC domain-like 1.57e-20
Family RGC domain 0.00093
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|30780|e_gw1.5.4.1
Domain Number - Region: 1121-1213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00584
Family Motor proteins 0.028
Further Details:      
 
Domain Number - Region: 1207-1266
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0337
Family TF C-terminus 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|30780|e_gw1.5.4.1
Sequence length 2018
Sequence
MPDIPTTPLGSNPSPPKPFTSSQPIFGYQARLLQRTSSTKTSGTPISGSSGLTSSLANMA
MGPPAPPNGTSPPSTPITRSVKRMVAEGNRQNGPEFATPGLRGSAGLSKTPSSISSHTRG
SQSVSSVRNQWQAKINKLSTTPLSEASLPPNGSQQTPKSLKRSTFSPDLTTGMGFALSNI
STPSSIIPIRTGSSTTDSVPDVNKYQSDFMASKTAKRSTVFGMEGITASPIPTPIERPST
PPSSSSVISDQSPTTRQRPASVSSYASILSPHSTGESSVTSGRTQAQEEKLAAARANALK
RLEARRKAQAEAAGEGNATMKATASQDIPAEVTIRASPPAAPITSTPEPTAVRSSPFAHL
FEPPSSNTEKTPTKPTFHFSENVTPTSSRSYISRSTAASSTTPAPSAAPSYVPSGLSVPA
ASSTSSGPGLLGGKDKYGSISKTDRRRLGRHLPRIASGGEGWDEEVVPGHKDMSEKRIPS
SLGRNAIAPSKTENTPPIPTPDRPSTSAPSSRPRAMDVLAPSTTTNQPNTVPSQSVPSTP
SKRRSVMVAEKLKESLASTPRPEVAGEEMKGLMSAVGALGVRGRSKEGGEGVTGMANRFR
LSKSSLPPSASSAALAPAPLPSRKLAQTNWMDRQRHALQAYEYLCHVGEAQQWIEGCLDE
ELDFGVTEMEEGLRDGVVLAKLARVFLGESAVKHIYTDGKHRYKQTENINYFLRLLRSVG
MPETFIFEVTDLYNKRNIPKVIFCIHVLSHLLSRLGRAERIGNLVGQFEFTDEQLAATQK
GLQGVPMPNFGDVRNTLAKEASWEPEEPEETEDEKRDRELIECEPSIINLQSHLRGRLAR
AKTSRIRTQLDLALPIITRIQSQARGYLARQILKAERTERSHLSSWATGLQAIVRTRIAT
TRWQQRILSVRRSEASAVGIQAHARGMLARVRLATIENALDKSSRHIVNLQAICRGCLAR
RRRSEHRRAMSTPEMVQTIRSLQAVSRGRLQRQAAAQQQLKVHSQMQTFLAFQSHLRGAL
VRRTRRAHEEKLDNAADYIVSIQAVCRGILARRKKQSFISTAQTVAPAITSLQSALRARL
AKQSHRNMQKALAKVEVAGSVGGLQAFLRTKLAKRQATEQKKQLEFVQPDVIGFQAIARG
YLARQEYREWRDYLFDPHTQGALVFLQSLIRGFLARRRLYLRTSYIHSRIDSIVKIQALW
RGRTERQMYHRLLTGMEVDVPTIQNYMHLLNDTESDFRDQIRTDLLRKQVVELIRENQIL
ETDVKDLDTKIALIVNNKMTFEELARAKRRAGQGQQEQIWHQTNMDPFGGGAHLDKGSQR
KLELYEGLFFLLQTKAEYLSRLIRGLKGDEVEKDRKMVEGVVLVLFGYERREEYLFHKLL
QLAVHEEILLSTTLSELAEHRLPIVSVTKQYAKPSVTPYVQEIMSEHILRVVQAQDLDLC
TDPLEIYNRSINAEESQTGLPSPRPRDLNADQVLQIDAPARAEYIQHLQELRFLCDRLIK
GLVASTVHVPYTIRLLARESLLALRVKYPDAFDHELTPVVAKTVILPFLLPAIIAPETFG
ILDTPIGAIERRNLAAIASLVTHVASQDLSSSTKDRFIRVPLQEYIRADGEVFRDWIMEL
ASVEPLETYFQTHELFESALEAKPISITRSEIYGMLGVMVRHLAIVSGGKTADPVAKILD
ELEGPPLEYDKSKIPISLRLTNRLAQLQSNDDDAPGKEDWVQAKRHVLAVLRIQSGRTLF
DVLVARPEQIHEQMWIQEVHRDMALETARQGTHQLPPTPVEKEYQIESIRSLPFHEVKCR
AIEFCMRLESLGRLSRADAFQGLLVSIAGDIRQKHHLRKMQKQSLVAMTRAYEDLSAKKR
KFEEQIKSYHDYIDSSMASLQAKGKKKPTFLSKQYRHQRHEAKLGKKSRFGSYAYTATEL
YDRGILLAIDQFSPRQYDKVTLVIASDEVGVFSLEMASSASAASSTLIGHEELRMEDLLQ
AQFDNEQSLLLFDGMATFSINMLIHQINKSEFLFLRRI
Download sequence
Identical sequences XP_007004465.1.33187 jgi|Treme1|30780|e_gw1.5.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]