SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|40084|estExt_Genewise1.C_90272 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|40084|estExt_Genewise1.C_90272
Domain Number 1 Region: 187-289
Classification Level Classification E-value
Superfamily EF-hand 3.38e-26
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 44-141
Classification Level Classification E-value
Superfamily EF-hand 3.27e-19
Family Eps15 homology domain (EH domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|40084|estExt_Genewise1.C_90272
Domain Number - Region: 430-546
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000107
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|40084|estExt_Genewise1.C_90272
Sequence length 674
Sequence
MSIPGPWPSFKGFKPPPNAPSNQFTSQTPISTQNTGQTPLTANSTGSGLPPLTQADRTKF
TRIFVGCGPQNGLVSGDKARDVFVKSHLNYEKLGKIWNLADTQQRGSLDLPDFIIGMYLI
QSCMANPSLTLPATLPPGTYEIASGGRPPPPPPTESPLARQHTGTASPVRAPAVSALGNS
AFAPVRQMTAQQPAWDVTPEAKANSDRFFAQLDSQNKGVIDGDIAVPFMIQSQLDEGTLA
TIWDLADIRKEGKLTRDEFAVAMHLINSKLEGKDLPTILPRSLVPPSLRGQFDSGPQEVL
SSTGPASATKDLFDLFSDEPAQVSATASNFGTSAPAPAQRQPSGVQALQPTTFLSQPPTR
RGTGQPAARQLSPASTGQQQSVFQAAPFVAPTQPPGDLLGDDTAQAALSVSNNSVELGNK
QNQLANTTRNLEGVTKTRAELEATAASSAKQIEELEKKLSEAKAKYETETQAVADLRIRV
AQQAEQLKKIQSEVISAESDLSAMRSEKDELGQALLRDKEEVRGLQKMMKEIEDEKGPLK
AQLEKVKKEARQQKGMVTIAKKQLSTAEASRDSLKEEIVEEEKATAEPEIHPETELAPTP
FDSHRTVSPPGFAVAAAVPLPATPSALSPVPTGVSQRSNNPFERLKAAAQAQPPAPDSPT
GPISPAIETSSPSM
Download sequence
Identical sequences jgi|Treme1|40084|estExt_Genewise1.C_90272 XP_007006042.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]