SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|40611|estExt_Genewise1.C_120154 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|40611|estExt_Genewise1.C_120154
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-34
Family G proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 456-621
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-20
Family G proteins 0.0086
Further Details:      
 
Domain Number 3 Region: 167-241,281-302,345-411
Classification Level Classification E-value
Superfamily EF-hand 5.91e-16
Family Calbindin D9K 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|40611|estExt_Genewise1.C_120154
Sequence length 690
Sequence
MPRRDLVRIVLVGDDGVGKSSIITSLIKESFVSNVPHVVPEVTIPPEVTPENVTTSIVDT
SANPRSRPHLLSQLTRAHVICLVYSISEPSSFDRVAEFWLPLFRREGINVPVILVGNKID
LRGGTVTNQGLEDEIAPIMREFKEVETAVECSALLPLNVSEVFYFAQKAVLHPTAPLYDS
REHTLKPKCLDALKRIFKISDIDKDGLLNAVELNQFQQKCFSAPLQSQELEGILDLVRSY
DTSLVRPIPAFSAPSTPLPRDASYGQLGATHSPNLSLSPSGEGITELGFLYLHTIFIQQG
RMETTWTVLRKFGYGEGLDLREDFLTPRFDVPYDCSVELSPLGNQFLTDIFESYDKDQDG
ALSQSELDDLFSTSPGNPWLAQGFPDTTITDDLGRVTLQGWLAQWSMTTLLDHRTTLNYL
AYLGYSSSPATDLPSSSALQVTRPRKQDRRQRKVTRNVFLCYVLGATGSGKTSLLRSFVN
KGFGGGEDGVGGYEPTTRVLSVVNSVEMEGVEKYLVLQEFGSKYESETLRNSKKLDMADI
IIYVHDSSDTNSFSYISNLRQQYSLDHIPALFVATKSDLDLAQQRHEVQPDVYCRRLGLP
APMAVSARLGPMINLWVAITRVALNPNSSIARGPSSSISPAQRVRLIAAATISATTLTAI
VGVWMRYQGYTWRGLWGWFGRVGLFGSKSP
Download sequence
Identical sequences XP_007007020.1.33187 jgi|Treme1|40611|estExt_Genewise1.C_120154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]