SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|40774|estExt_Genewise1.C_130191 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|40774|estExt_Genewise1.C_130191
Domain Number 1 Region: 973-1128,1171-1249
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000541
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 1303-1539
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000863
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 111-172,265-363,432-499
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000863
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 4 Region: 540-765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000275
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|40774|estExt_Genewise1.C_130191
Domain Number - Region: 1550-1589
Classification Level Classification E-value
Superfamily EF-hand 0.000839
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|40774|estExt_Genewise1.C_130191
Sequence length 1873
Sequence
MRNGTIRSMTRTIRQASVRVVNIVGHDEPGMVRLQDENVWDGDGPASGSKEGLETEGEEM
YEMRREEMGMDIPAPRPGPLPPEPGLRGRTLGLFGVKSRIRRSMAGVLGWSWTEPVILLL
IIANVVVLAIQGSTPLTSPRLDPGYFTSWEDYVLFALFIVFTLEMFARMVVTGLILDPDT
SIREYLFAPTGLIPSIEKHLNISHTSSKTILNRPTPIAKPHWAARRTSTVDLPSASHKKT
TLPATISELPFQRAVARQQALAAYGRPYLRHSWHRIDLVAVVAFWLMFILAVIGQEATST
YHVYLFRALSVLRAARLLVVTSGTSTILHSLKRAGPLLVTVAYFVVFAGVLFSIIGVQSF
RGSFRRQCVLTNPFNGSDTVQTGQACGGWLNVSGEVVSYLNLDGSVADQGSKGYICPMNE
VCQTLSTNPNGNAQSFDNIFAALVQVIVISSVNTWAQTMYMAMDSDYYSSSLYFLSAVIV
LNFWLINLVVAVVVNTFKDIRAATKRSAFGADQSMLGIDNPWANENKSMKKSALLRLYER
TEITWVLLVVVDLVAQACRTASSSPDTLTLLKNLELVFTLVFDLEILIRAAGHIPEWKAF
LASPRNSFDLFLALTCSIIQIPAVVHAGVYPWLTVFQLLRWYRVILAFPRMKPLLITVFG
SFAGMLNLIVFLILINFIGALVAIQLLRGDLTSDQTITFSQTYNSFLGMYQIFSSENWTT
VLYGAMSAEYQWAQGWLAAIFLCGWFLFAYFIVLQMFIAVINENFAVAEEQKRKQQIEAF
IRKSEPVSVHVSWIDRLNPYRLIKAHHRAVKVNALPANLVLPLKQSVGAEVGGISNKMKA
EMEKEDSNAPMRRLFGFERDEKLPRRRSRLLSTRMDDMGHMEDDDRGLTDLLPPLTTGPS
ADEHLDTLRERRNKQADFIAAHPSFDQSLWLFKQRNPIRRFCQSCVSPAYGERIFGRPPN
PILRLSVKIAVFVAVVASIVVAAIATPMYRKNFYARHGIYRGTWFDLTEVALGSVFIFEA
AIKIIADGFIFAPNAYLLSLWNVLDFIVLITLVVNTTTSLIFIGGLSRVTRALKSFRALR
LITLFGRLRDTLHAVLFAGALKILDASILMILYIIPFAVWGVNIFAGKLYSCNDGNASGI
SNCINEYLSTPIDDSLAFLAPRVWENPAGLGQTVWNFDTFRSSILILFEIVSLEGWIDVM
TSSMNIAGRDLQPVSNASQWNAIFFVIFNLLGAAVILALFVSIIIGNFSLRSGSALLTAE
QNHWQDLAKFIKAQTPSQLPKLRPQTALREWCYERATNKHGYWTRAFTGLYYIHIFLLMT
EDFSNNILNDVALDWVFLLFSLIYAIDILVRFYGLGFKSFRANGWNLFDVIVVTGSFATT
IPALRAASRGLPGDQVNIQLQKLFLVSIALKLVQRISSLNQLFKTSVASLPAIGNLFLLW
ATLFIFFSILYLEVFGLTKQGDNSGSRFQNYYSFGNTLIMLAFMSTGEGWNGYMHDYTIT
FPRCTENKDFFLTDCGSPSWAFGLYIFVNMFTGVVVESFAYVYQMPGGASLNREEMRAFK
KVWAEFDVERTGYIRKKDFIKFFSQLSGVFEVRPYPPEYSVHNIIRSSIPDPVANASGRV
LVAKGVEYAVDVRKVETLVERIDFNRVRDRRRVFNRLYHEARISEEPGRGISFTHMLMML
SHYKLIDDEKALLLDDLLIRRAKTDRVTDLVNLERVRGLLRTIWCRKRFLVAREENRRAL
NGEAMGIPAIVLEPTPNTPEEENENPFDTSIRETLSSPSPVDSRATSPAASPALRPSPTL
HTPGSTHSRYPSFSQNSMRTPLSRQPSDASMLSSEDAHRRAESVDEPHTEGYMESMATSV
WGDMMRHAVDEET
Download sequence
Identical sequences R7SCP3
XP_007007287.1.33187 jgi|Treme1|40774|estExt_Genewise1.C_130191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]