SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|41782|estExt_Genewise1Plus.C_10948 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|41782|estExt_Genewise1Plus.C_10948
Domain Number 1 Region: 621-679
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000032
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0032
Further Details:      
 
Domain Number 2 Region: 485-548
Classification Level Classification E-value
Superfamily EF-hand 0.0000127
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|41782|estExt_Genewise1Plus.C_10948
Sequence length 892
Sequence
MPEERVKRTDYFQSQPIPTPPNQSYQGHFRAESVDVVDDDYEPHQIGRSDSRTPLTPPHD
TNHLLPIAPQGPTQQYLSPPQPLPTTGLNAAGNRVHYPPSPYMAKHQEYSTIPLNDQTPI
SGRSSPMPTPVSGQSTPNGTGNKKKHWSFLPMHSTPSSLEAGENINEKQKKRPKSSRNNS
WDLLGDRAEWDEFNPAQASVENLRYAEGDVGTNKLSRLYYWALNRGIVVRWALYILPILA
LLWLPGILGVTAEKNATIWHIKLIWWSIWATVVWVGFWVSTAVFLMLPSIWRNTVGSIIP
TARAYTDVVRNLGFYAKLIAWTLANWISFTPLLINHYIGDQSATSRNDLTTFANVLFGIF
LCTIVLAVEKLIIQLIALQFHRDSYEDRLKEQKMNVRCLTTLYINSHDIPGRMDTLTDGA
SGSTGRTRATKIPQIAIRKALRGLKSAAQNTTTALGNVASEMAGQSVLQTNSPANKVTAA
LSSANKSRALARRIFYSYRQGGADHLDISDIARYFPDLETAQAAFSIFDKDGNGDATRDE
IDASVLGMHRERLSLEASMRDLDGAVRRLDDIFMVVVVAISILILAATITTKLTTLVTSA
GTFILGLSWLIGSTMQEILGACIFLFVKHPYDVGDRVDIDGSAYTVVKMNLMSTSFKRVD
GKYVWIGHNILTTKVIENVRRSGATSESFIFEVDFETSFETLQELRGRMLRFVKDNSRDF
QHVFDVTVDDIPAQGKMVLKADIRYKSNWQQGALKVQRRNKWVCALKMTLKDLKIWGPGG
AGDPSPPPPDPVKYTLVPYEPTQPSVQPESPPPTFQTATAAHHATSLTGRREVINDPSQD
IWDEEDELGSASRPGTPGPNTPVTDSGMRQRLPPVQVTDGSIEMTSAPVARR
Download sequence
Identical sequences XP_007000950.1.33187 jgi|Treme1|41782|estExt_Genewise1Plus.C_10948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]