SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|42026|estExt_Genewise1Plus.C_11513 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|42026|estExt_Genewise1Plus.C_11513
Domain Number 1 Region: 57-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-80
Family Calponin-homology domain, CH-domain 0.0000403
Further Details:      
 
Domain Number 2 Region: 303-424
Classification Level Classification E-value
Superfamily Spectrin repeat 8.63e-23
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 528-637
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000161
Family Calmodulin-like 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|42026|estExt_Genewise1Plus.C_11513
Domain Number - Region: 426-529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0064
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|42026|estExt_Genewise1Plus.C_11513
Sequence length 685
Sequence
MSTSLERRGSAQNLPPPPMSPRSHGRNKSLGNIGMALGVGVSSAPMTPHGSGSPVLGAEI
EWADIQARTFCRWLNTKLESQGLAPMTDLVRDFSNGVKLIELLEIMSETSLGRYNKKPTM
RVQKAENASKALQFIRDRGVKLTNIGPEDIVDGNLKLILGMIWTLILRFTIAGITEEGLS
ARDGLLLWCQRKTQPYPEVNVQDFKKSWSDGLALCALIHRHRPELLNWDRLDKDDRRTNT
ELAFKVAEQSLGIPRLLEVKDLCDVEVPDERSVMTYVAEFFHKFSSEDKAETGARRVEKF
AELMQGIWTNKNDFERRMALLLESLQSTEESWRRAQQPSTYPEAIAHLAAFADYKKTSKR
SYVKERQELAALYSNIQTKLRTYALKSWEPQPGLCLEDLDKNWAVFLEAEKLRSRAINAR
IRDIKEALRKQFARAAESFIARIQRIEQAIGLLSGLLPDQKQILQHLSSELPSLQATLSS
DILTINQACLEAKVEENDHTVYSFEDLLYELELAEASIRKKLAFVDNQMVSATHTNITPA
KLEEFEATFKHFDKDDTNTLTLWEMHSALASLGIVYADEEIEVIYAQLETDFGAVTYQAW
LALLTDITQDDSSSADQLRDAFRGIAGDKPYITDLDFKLASLPTETIKFLCETIPETQPP
ADGPADASASKRYDFYTYLETTFAR
Download sequence
Identical sequences jgi|Treme1|42026|estExt_Genewise1Plus.C_11513 XP_007000982.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]