SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|42604|estExt_Genewise1Plus.C_20272 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|42604|estExt_Genewise1Plus.C_20272
Domain Number 1 Region: 113-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.26e-167
Family Calponin-homology domain, CH-domain 0.00000000000377
Further Details:      
 
Domain Number 2 Region: 8-93
Classification Level Classification E-value
Superfamily EF-hand 0.00000000208
Family Polcalcin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|42604|estExt_Genewise1Plus.C_20272
Sequence length 623
Sequence
MQAIRLGKKYPEFKQDELFDLINKFKQIDVEDRGWLEKPQVIAALQQSGDADYDSARETL
KSVNTDSSGRVELEDWVQFHSLLRQGKTQPVLEHKKGKISVKGTAGTNAQHTINEDERTS
FTDHINGVLGGDLDIGHLLPIPTDTMQLFDECRDGLLLCKLINDSVPETIDERVLNKPGG
GKAKGKNLNAFQMTENNNIVITSAKAIGCSVVNIGPSDIAEGREHLILGLIWQIIRRGLL
SKIDIKIHPELYRLLDDGETMEAFLKLPPDQILLRWFNYHLKAANWPRRVTNFTKDISDG
ENYTVLLNQLKPDQCTRAPLQTRDLHQRAEEILQGADRIGCRRFLTPSSMVSGNPKLNLA
FVANLFNTWPGLAPLEEAEAPVIEDFDAEGEREARVFTLWLNSLDVEPGVYNLFEDLKDG
YVLLQGFDKVIPGSVIWRRVTKPKEGQELSRFKAVENTNYAVDLAKGNGMHIVGIQGSDI
VDGTRTLVLGLVWQLMRLSISQTLASISENGKSVTDQSMIKWANETVKKGGKSSTMRSFK
DSSLSTGIFFLDLLNGVKPGYVDYSLVHKGVNEEEKRQNAKLAISIARKMNALIFLVPED
IVDVRPRLLLTFVGALWSASLHQ
Download sequence
Identical sequences XP_007002532.1.33187 jgi|Treme1|42604|estExt_Genewise1Plus.C_20272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]