SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|45697|estExt_Genewise1Plus.C_140169 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|45697|estExt_Genewise1Plus.C_140169
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily EF-hand 7.19e-55
Family Calmodulin-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|45697|estExt_Genewise1Plus.C_140169
Sequence length 149
Sequence
MADQLVTEQVAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NNSIDFAEFLTLMARKMKDTDSEEEIKEAFKVFDKDGNGYISAQELKHVMTNLGEKLSDT
EVDEMIREADKDGDGQINYNEFVQMMMAK
Download sequence
Identical sequences R7SC24
XP_007007533.1.33187 jgi|Treme1|45697|estExt_Genewise1Plus.C_140169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]