SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|67577|fgeneshTM_pm.2_#_65 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|67577|fgeneshTM_pm.2_#_65
Domain Number 1 Region: 506-620
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.68e-23
Family PLC-like (P variant) 0.068
Further Details:      
 
Domain Number 2 Region: 90-225
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-18
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 3 Region: 615-638,666-726
Classification Level Classification E-value
Superfamily EF-hand 0.0000000274
Family Penta-EF-hand proteins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|67577|fgeneshTM_pm.2_#_65
Sequence length 1252
Sequence
MTSEAVSPPSAAPNSKPRLKRLAARPLKLAASTFRPLSSSRSGATAPVAVISSSTTLVGS
TQQSDGNAGALTPQQVASAARGPRKPLEGEEPAAWLRVRVVKAEGLVAKDRGGTSDPFVS
LVLPPSGRHSTPVVKKSLSPTFVPESSTFDFPLYLSLAGVIGGRGLEAIIWDKDLMRKEY
LGEISIPLQEWFEDLQVRLWNDNPAPRTWSLLSTRRKRTVSGTITLQIGFVPPKEALSRE
EALKKIKMIFSTIVERASAGRGLAGVLGVPAYEGIGTIKMRSSRPPLPETAFTPSPTVAA
GHSPMALLQSATASIVAPLAGKNRSEPNAQSASAVADIDDDHSDDDDMLFPDDGLSTSST
SDEFEDALEEEDETQINDSQPLMKQGITERMVEALYHQSAGLPPPRSADLKRVESDGGTP
KTASLVPPETKPMKTPTRQSSLPGYFDRPAKTDESPGPSTPGMTPGMVTPGGTKLRKPLF
KRTKSNAPSRKSTKDFNFDASQGKQVLGIVVMEIKSASDLPKIKNSLRLSFDMDPFVVIS
FGQKVFRTRVIRHSLNPTWDEKLFFHVRRHESTFTVKFAVLDWDKISGNDMVGTATLPLN
ELMGDCPKPNPKTGLYGKNEDGKHEMKEFTLSLSTERDMPWESKHSPKLTIRAKYEPYDA
LRQRFWRQYIAQYDADETGTISYTELTAMLDSLGSTLTRSTIEGYFISCGKSADKDELTI
DELIQSLEYEVTKSRAEKAPVNKDDPSPSIGSGMQTPSVAPKPVLDGLSMTGPSAAISSP
VDADELAEHIRRSTLDSEPGDGTGGNMRPVNKTPGSDLSIPVLKVERVSSMDGESRSVSA
SGAATPAMSDTEDADSLDERERIINIRTCPLCHRSRLKRKSEQDIVTHLAICASTDWTRV
DRIITASYVTSSQAQRKFMTRIVNKVAVGAYSLGANSANILVQDRLTGQLQEEKMAVYVR
LGIRVLYKGAKSRMEGTRARKLLKSLSVKQGIKYDSPSSVVDILPFIAFHRLNTDEILEP
ISSFKSFNQFFYRKLKPGARPVDEPGNEARLVSCADCRMMAFETVDEATSIWIKGREFTV
GRLLGPNYKDVIERYNGGALAIFRLAPQDYHRFHSPVAGTIGKMTMIDGEYYTVNPQAIR
TTLDVYGENVRKIVPIQSEEFGLVMTVWVGAMMVGSILTSVKEGQHVNRADELGYFAFGG
STIVCLFERGVMEWDEDLLANGRAAVETLVRMGMGIGRSTRSAQKTGTPRVS
Download sequence
Identical sequences jgi|Treme1|67577|fgeneshTM_pm.2_#_65 XP_007002973.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]