SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|68331|fgeneshTM_pm.4_#_42 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|68331|fgeneshTM_pm.4_#_42
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily EF-hand 5.51e-33
Family Calmodulin-like 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|68331|fgeneshTM_pm.4_#_42
Sequence length 141
Sequence
MQTNNIEYREAFALFDKKGTGQVPRESLGELLRSLGQNPTQAEVTELERQVGATFGYDQF
LQVLNRPDGWKPAGTADEFIKGFQVFDKAGNGFIGAGELRYVLTQLGEKMSDEEVDELLK
GFPVQDGQINYHSFVRSILAQ
Download sequence
Identical sequences jgi|Treme1|68331|fgeneshTM_pm.4_#_42 XP_007004283.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]