SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|68922|fgeneshTM_pm.6_#_95 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|68922|fgeneshTM_pm.6_#_95
Domain Number 1 Region: 37-121
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000518
Family EF-hand modules in multidomain proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|68922|fgeneshTM_pm.6_#_95
Sequence length 299
Sequence
MSKPLFNLALLSLVFAHSEHSFDLDDAADAGMSYAERHMHTEHHIDSFDLPSFFKLHDLD
SDGYWDQKEIAAVYGLYHHKVKDKVPETEEHKAKVEEIVNVVLQRLDTDRNGKISLVEYI
AGGNDGLPNFPGYKDLGHHYDEESEYFLHHEELYHSTPETQTDESYVHQEDIEHFQHHIH
IEAEEDARERIFEGLPPDANLEMDHVASDPLDEHAHAPGEGPSDVPPQSDPEKDLKPGDE
VPPPPKIQRVTPGASPARLGREDEEKLYKPDERHGRGREAGDRLPYKSRFRKGLRTDEF
Download sequence
Identical sequences XP_007005194.1.33187 jgi|Treme1|68922|fgeneshTM_pm.6_#_95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]