SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|71100|estExt_fgeneshTM_pm.C_20131 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|71100|estExt_fgeneshTM_pm.C_20131
Domain Number 1 Region: 239-401
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-35
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 2 Region: 606-721
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000196
Family Calmodulin-like 0.0048
Further Details:      
 
Domain Number 3 Region: 377-474
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000445
Family Ypt/Rab-GAP domain of gyp1p 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|71100|estExt_fgeneshTM_pm.C_20131
Sequence length 1024
Sequence
MSLPMHLRSYREKSKDESARDFFNVPPQEALPRPGDPPSVVKLHTYLSREGTGLQGMDIN
AVLSVEGKEEVYAGRLSLLPPFLCFISLDRRSCRCTLPLYIIRRVERLNSRAGVFALSLA
TWHGMRIILQLTSLLPTAEHFSILLRDALKSQLAAMKQLKPFLPSLYSEFLLSSPAAGVN
PQAPDHLLLGTELGEKVTEGEGDLRGPGGADKGNYDRGLGEVFGFPGDARKMRERSKMKL
WREYFVIHGRNFTLLRYPPFQRLLQVGLPSRLRGELWEVLSGSIYLRFSNPQTYQLLLST
NAGKSSQSTDEIEKDLNRSLPEYKAYQAEEGLARLRRVLVAYSFRNPELGYMSEEQAFWL
LEVLCDRILPGYYSPSMEGTLLDQRVFEAVVGRCLPMIKDHFTSVDVQLSVASLPWFLSL
YINSMPLIFAFRVVDCVLAMGVKVLFQIGLAVLKINGEALLEVTDDGMFINLMRSYFSTI
GDSAHPNHPDPRVRAITNFQELLVVAFREFNVITDETIQSERRRLRAIISDEIEKFSKRA
AVRNLKAVGRFNKDQIGIVYDHYFAAVCSPEAYINSSGSSTPLLSPGDQFNQPRIQVDAQ
GRVETRIDLRTFKVFLSQIATWAREEVVTTNAFIQRTERKIADHDLIDRLFFSWDTQQLG
TLSLQDVVIGLDTVMTSGLMESIEWFFNLHDKNKDGYLTKDEVIQLSESLLFIFRNEPGD
VYLAAVSKFILNAYEFGDATAPQESLPSPDDVKPINGEAVTASHARERSNSTAGPHNLPY
LNLATFRMVVLADEILETFFDKDLAASFQLDSTGEEDYHQAHQKPEGLLGGLMNLVVTNE
NKNRLNRLADGFGAALGKHAEWRKPALSKSPAQPSTSDLGTRESLLTPQQQQQRGRSQSA
ASQASMQSAKSGSSSVNTIAERSSLADVEARYREESEMVKAAQEAVMQRPNFAIDAIGDS
DGEDEGGEDDTGVMDEVEAFLKAHGDDDEGLKGEQKKVAADLLKAEPMGSKSVEKAGPSS
LVDL
Download sequence
Identical sequences jgi|Treme1|71100|estExt_fgeneshTM_pm.C_20131 XP_007003067.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]