SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|71992|estExt_fgeneshTM_pm.C_80141 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|71992|estExt_fgeneshTM_pm.C_80141
Domain Number 1 Region: 145-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.22e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 2 Region: 283-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.32e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 
Domain Number 3 Region: 458-537
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000329
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|71992|estExt_fgeneshTM_pm.C_80141
Sequence length 651
Sequence
MLGDLVRRGNVMVKVMFPIKRRPGVLFSGLNLPMTCRELTMVHPNARAVNRDSLIASGSN
TFPSAHPVISFCVRLALSSILGIGVVVTVILLHDATTYSERHVDRVPCNPLSLHPRTGGK
KNLPIVEVNLDDEEDDAKRAMKDKPKLVVIGGGWGAVALLQSLPPSAYNVTLISPQTYFT
FTPLLPSACVGTVEPRSLVEPIRKLIARVRGHYLMGAAVDLDMAERLVEVEVASDQGTGT
IRCYVPYDKLIIAVGSTSNDHGVKGLEHCFQLKTVPDAQAIRRRVMNRKRLLSFVICGGG
PTGVEFAAELRDMMAEDVLKYYPKLLESEVQVHVVQSQDHILNTYAEKISQYAEQKFKRS
DVNVIVNARVQEVTPNSVKLTLKDPKNKEAKPEEAELAAGFVLWSTGIAMQPFTRRLVEL
LPNQFHSKAVEVDSFLRVQGAPKGTVYAVGDAATVHTNLVNDLMDLWEKFDENKDETLDF
DEWQKMSKHIKQKYPLASKNLERLRELFDEFDKDQDQRLSLNEVAEMFQHLSQKMTSYPA
TAQVASQQGKYLGKKFSKLARQYKVLRENDMPDLDDEAFYDPFVYRHLGTLAYIGNSAVF
DYDGWSLAGGLLAMYAWRSIYWSEQTSMRTRMLLMLDWVKRGIFGRDLSKF
Download sequence
Identical sequences XP_007005937.1.33187 jgi|Treme1|71992|estExt_fgeneshTM_pm.C_80141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]